CX300545
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX300545 vs. ExPASy Swiss-Prot
Match: RL40_LEITA (60S ribosomal protein L40 OS=Leishmania tarentolae GN=UB-EP52 PE=3 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 5.165e-14 Identity = 32/52 (61.54%), Postives = 43/52 (82.69%), Query Frame = 2 Query: 221 IIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 376 ++EP+L+ALA+KYN +K +CR+CYARL RA NCRKK CGH + LR KKK++ Sbjct: 1 VMEPTLVALAKKYNWEKKVCRRCYARLPVRATNCRKKACGHCSNLRMKKKLR 52
BLAST of CX300545 vs. ExPASy Swiss-Prot
Match: RL40_LEIMA (60S ribosomal protein L40 OS=Leishmania major GN=UB-EP52 PE=3 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 5.165e-14 Identity = 32/52 (61.54%), Postives = 43/52 (82.69%), Query Frame = 2 Query: 221 IIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 376 ++EP+L+ALA+KYN +K +CR+CYARL RA NCRKK CGH + LR KKK++ Sbjct: 1 VMEPTLVALAKKYNWEKKVCRRCYARLPVRATNCRKKACGHCSNLRMKKKLR 52
BLAST of CX300545 vs. ExPASy Swiss-Prot
Match: RL40_TRYBB (60S ribosomal protein L40 OS=Trypanosoma brucei brucei PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.503e-13 Identity = 32/52 (61.54%), Postives = 42/52 (80.77%), Query Frame = 2 Query: 221 IIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 376 ++EP+L ALA+KYN +K +CR+CYARL RA NCRKK CGH + LR KKK++ Sbjct: 1 VMEPTLEALAKKYNWEKKVCRRCYARLPVRATNCRKKGCGHCSNLRMKKKLR 52
BLAST of CX300545 vs. ExPASy Swiss-Prot
Match: RL40_TRYCR (60S ribosomal protein L40 OS=Trypanosoma cruzi GN=FUS1 PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.963e-13 Identity = 32/52 (61.54%), Postives = 42/52 (80.77%), Query Frame = 2 Query: 221 IIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQLRPKKKIK 376 ++EP+L ALA+KYN +K +CR+CYARL RA NCRKK CGH + LR KKK++ Sbjct: 1 VMEPTLEALAKKYNWEKKVCRRCYARLPVRASNCRKKACGHCSNLRMKKKLR 52 The following BLAST results are available for this feature:
BLAST of CX300545 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 124
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300545 ID=CX300545; Name=CX300545; organism=Citrus clementina; type=EST; length=557bpback to top |