CX300625
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX300625 vs. ExPASy Swiss-Prot
Match: HPPA_CHRVI (Pyrophosphate-energized proton pump (Fragment) OS=Chromatium vinosum GN=hppA PE=3 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 1.561e-12 Identity = 33/75 (44.00%), Postives = 46/75 (61.33%), Query Frame = 2 Query: 116 LFSYLVDGLC-SAVGKTAQEVVNEVRRQFIERPGIMEYKEKPDYARCVAIVASASLREMIKPGALAIISPLVIGL 337 L YL + AVG+ A VV EVRRQF E GIME KPDY+R V ++ A+++EM+ P L I+ P+ + + Sbjct: 80 LVPYLFGAMAMEAVGRAAGSVVIEVRRQFREIKGIMEGTAKPDYSRAVDLLTKAAIKEMVVPSLLPILVPVAVAI 154 HSP 2 Score: 29.6462 bits (65), Expect = 1.561e-12 Identity = 11/20 (55.00%), Postives = 16/20 (80.00%), Query Frame = 1 Query: 421 VSGILMALFLNTAGGAWDNA 480 V+G+ +A+ + T GGAWDNA Sbjct: 178 VTGLFVAISMCTGGGAWDNA 197 The following BLAST results are available for this feature:
BLAST of CX300625 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 41
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300625 ID=CX300625; Name=CX300625; organism=Citrus clementina; type=EST; length=686bpback to top |