CX305587
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_ROSS1 (Chaperone protein dnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 3.188e-11 Identity = 33/64 (51.56%), Postives = 47/64 (73.44%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE+LG+Q A+ EIK A+R+LAR HPDV ++ ++ KF +++EAYE LSDP+KR+ YDR Sbjct: 8 YEVLGVQRNASQDEIKKAFRRLARQYHPDV---NKAPDAEAKFKEINEAYEVLSDPEKRSMYDR 68
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_ROSCS (Chaperone protein dnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 3.188e-11 Identity = 33/64 (51.56%), Postives = 47/64 (73.44%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE+LG+Q A+ EIK A+R+LAR HPDV ++ ++ KF +++EAYE LSDP+KR+ YDR Sbjct: 8 YEVLGVQRNASQDEIKKAFRRLARQYHPDV---NKAPDAEAKFKEINEAYEVLSDPEKRSMYDR 68
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_RHILO (Chaperone protein dnaJ OS=Rhizobium loti GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 3.188e-11 Identity = 33/64 (51.56%), Postives = 45/64 (70.31%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE LG+Q GA +E+K+A+RKLA HPD + + +KF +++EAYETL DP+KRA YDR Sbjct: 6 YETLGVQKGADEKELKSAFRKLAMQFHPD--RNPGDHSCEHKFKEINEAYETLKDPQKRAAYDR 67
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_GEOSW (Chaperone protein dnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 3.188e-11 Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YEILG+ AT +EIK AYRKL++ HPD+ ++ ++A KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEILGVSKNATKEEIKKAYRKLSKKYHPDI---NKEPDAAEKFKEIKEAYEVLSDDQKRAHYDQ 67
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_GEOKA (Chaperone protein dnaJ OS=Geobacillus kaustophilus GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 3.188e-11 Identity = 35/64 (54.69%), Postives = 45/64 (70.31%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YEILG+ AT EIK AYRKL++ HPDV ++ ++A KF ++ EAYE LSD +KRA YDR Sbjct: 7 YEILGVSKNATKDEIKKAYRKLSKQYHPDV---NKAPDAAEKFKEIKEAYEVLSDDEKRARYDR 67
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_BACTR (Chaperone protein dnaJ OS=Bacillus thermoglucosidasius GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 3.188e-11 Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YEILG+ AT +EIK AYRKL++ HPD+ ++ ++A KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEILGVSKNATKEEIKKAYRKLSKKYHPDI---NKEPDAAEKFKEIKEAYEVLSDDQKRAHYDQ 67
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_SYMTH (Chaperone protein dnaJ OS=Symbiobacterium thermophilum GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 4.163e-11 Identity = 34/64 (53.12%), Postives = 45/64 (70.31%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YEILG+ AT EIK A+R LAR HPD A + ++A KF +++EAY+ LSDP+KRA YD+ Sbjct: 10 YEILGVPRNATEAEIKKAFRNLARKYHPD--ANKDDPDAAEKFKEINEAYQVLSDPEKRARYDQ 71
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_LISMO (Chaperone protein dnaJ OS=Listeria monocytogenes GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 4.163e-11 Identity = 32/64 (50.00%), Postives = 44/64 (68.75%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE+LGI A+ EIK AYRKL++ HPD+ ++ + KF ++ EAYE LSDP+KRA YD+ Sbjct: 7 YEVLGISKSASADEIKKAYRKLSKQYHPDI---NKEAGADEKFKEISEAYEALSDPQKRAQYDQ 67
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_LISMH (Chaperone protein dnaJ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 4.163e-11 Identity = 32/64 (50.00%), Postives = 44/64 (68.75%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE+LGI A+ EIK AYRKL++ HPD+ ++ + KF ++ EAYE LSDP+KRA YD+ Sbjct: 7 YEVLGISKSASADEIKKAYRKLSKQYHPDI---NKEAGADEKFKEISEAYEALSDPQKRAQYDQ 67
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_LISIN (Chaperone protein dnaJ OS=Listeria innocua GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 4.163e-11 Identity = 32/64 (50.00%), Postives = 44/64 (68.75%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE+LGI A+ EIK AYRKL++ HPD+ ++ + KF ++ EAYE LSDP+KRA YD+ Sbjct: 7 YEVLGISKSASADEIKKAYRKLSKQYHPDI---NKEAGADEKFKEISEAYEALSDPQKRAQYDQ 67 The following BLAST results are available for this feature:
BLAST of CX305587 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 56
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX305587 ID=CX305587; Name=CX305587; organism=Citrus clementina; type=EST; length=452bpback to top |