CX305780
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX305780 vs. ExPASy Swiss-Prot
Match: ACCO2_DORSP (1-aminocyclopropane-1-carboxylate oxidase 2 OS=Doritaenopsis sp. GN=ACO2 PE=2 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 5.337e-17 Identity = 37/68 (54.41%), Postives = 50/68 (73.53%), Query Frame = 1 Query: 94 NFPVINLENINGAERAAILEKINEACENWGFFELVNHGIEPEFMDTVERLTKAHYRKCMEQRFKELVA 297 +FPVIN+E + G++R A + + +ACENWGFFEL+NHGI E M+ VE + K HYR+ EQRFKE + Sbjct: 5 SFPVINMELLQGSQRPAAMALLRDACENWGFFELLNHGISHELMNRVEAVNKEHYRRFREQRFKEFAS 72
BLAST of CX305780 vs. ExPASy Swiss-Prot
Match: ACCO1_BRAJU (1-aminocyclopropane-1-carboxylate oxidase OS=Brassica juncea GN=ACO PE=2 SV=1) HSP 1 Score: 83.9593 bits (206), Expect = 2.649e-16 Identity = 34/69 (49.28%), Postives = 50/69 (72.46%), Query Frame = 1 Query: 97 FPVINLENINGAERAAILEKINEACENWGFFELVNHGIEPEFMDTVERLTKAHYRKCMEQRFKELVASR 303 FPV++L + G ER + IN+ACENWGFFE+VNHG+ + MD E++TK HY+ MEQ+F +++ S+ Sbjct: 7 FPVVDLSKLIGEERDQTMALINDACENWGFFEIVNHGLPHDLMDNAEKMTKEHYKISMEQKFNDMLKSK 75
BLAST of CX305780 vs. ExPASy Swiss-Prot
Match: ACCO1_DORSP (1-aminocyclopropane-1-carboxylate oxidase 1 OS=Doritaenopsis sp. GN=ACO1 PE=2 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 5.901e-16 Identity = 35/68 (51.47%), Postives = 49/68 (72.06%), Query Frame = 1 Query: 94 NFPVINLENINGAERAAILEKINEACENWGFFELVNHGIEPEFMDTVERLTKAHYRKCMEQRFKELVA 297 +FPVIN+E + G++R A + + +ACENWG +EL+NHGI E M+ VE + K HYR+ EQRFKE + Sbjct: 5 SFPVINMELLQGSQRPAAMALLRDACENWGLYELLNHGISHELMNRVETVNKEHYRRFREQRFKEFAS 72 The following BLAST results are available for this feature:
BLAST of CX305780 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX305780 ID=CX305780; Name=CX305780; organism=Citrus clementina; type=EST; length=308bpback to top |