CX306356
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF_FRAAN (Profilin OS=Fragaria ananassa PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 5.888e-11 Identity = 29/32 (90.62%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 AL+IGIYDEPMTPGQCNMIVERLGDYL++QGL Sbjct: 100 ALLIGIYDEPMTPGQCNMIVERLGDYLVEQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF3_MAIZE (Profilin-3 OS=Zea mays GN=PRO3 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 5.888e-11 Identity = 28/32 (87.50%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 AL+IGIYDEPMTPGQCNM+VERLGDYL++QGL Sbjct: 100 ALVIGIYDEPMTPGQCNMVVERLGDYLVEQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF2_MALDO (Profilin-2 OS=Malus domestica PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 5.888e-11 Identity = 29/32 (90.62%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 AL+IGIYDEPMTPGQCNM+VERLGDYLI+QGL Sbjct: 100 ALLIGIYDEPMTPGQCNMVVERLGDYLIEQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF1_CITSI (Profilin OS=Citrus sinensis PE=1 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 5.888e-11 Identity = 30/32 (93.75%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 ALIIGIYDEP+TPGQCNMIVERLGDYLI+QGL Sbjct: 100 ALIIGIYDEPLTPGQCNMIVERLGDYLIEQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROFA_ORYSJ (Profilin-A OS=Oryza sativa subsp. japonica GN=Os10g0323600 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 7.691e-11 Identity = 27/32 (84.38%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 AL++GIYDEPMTPGQCNM+VERLGDYL++QGL Sbjct: 100 ALVVGIYDEPMTPGQCNMVVERLGDYLVEQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF4_HEVBR (Profilin-4 OS=Hevea brasiliensis PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 7.691e-11 Identity = 29/34 (85.29%), Postives = 33/34 (97.06%), Query Frame = -2 Query: 415 SAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 516 S ALIIGIYDEP+TPGQCNMIVERLGDYL++QG+ Sbjct: 98 SQALIIGIYDEPLTPGQCNMIVERLGDYLLEQGM 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF1_SOYBN (Profilin-1 OS=Glycine max GN=PRO1 PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 7.691e-11 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = -2 Query: 418 AALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 513 AALIIGIYDEPMTPGQCNM+VER GDYLIDQG Sbjct: 99 AALIIGIYDEPMTPGQCNMVVERPGDYLIDQG 130
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF1_HEVBR (Profilin-1 OS=Hevea brasiliensis PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 7.691e-11 Identity = 29/32 (90.62%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 ALIIGIYDEPMTPGQCNMIVERLGDYL++QG+ Sbjct: 100 ALIIGIYDEPMTPGQCNMIVERLGDYLLEQGM 131 The following BLAST results are available for this feature:
BLAST of CX306356 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 18
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX306356 ID=CX306356; Name=CX306356; organism=Citrus clementina; type=EST; length=517bpback to top |