CX308548
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: RC23_ARATH (UPF0057 membrane protein At4g30650 OS=Arabidopsis thaliana GN=At4g30650 PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.256e-13 Identity = 39/64 (60.94%), Postives = 50/64 (78.12%), Query Frame = 3 Query: 84 ETFLEVILAILLPPVGVFLRYGC-GVEFWICLLLTVLGYIPGIIYAIYVLVG**IKNYDVVTEL 272 E F E+++AILLPP+GV L+ GC VEF ICL+LT+LGYIPGIIYA+YV+V +N + TEL Sbjct: 6 EVFCEILIAILLPPLGVCLKRGCCTVEFLICLVLTILGYIPGIIYALYVIV---FQNREGSTEL 66
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: RC24_ARATH (UPF0057 membrane protein At4g30660 OS=Arabidopsis thaliana GN=At4g30660 PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 8.141e-13 Identity = 35/51 (68.63%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 84 ETFLEVILAILLPPVGVFLRYGC-GVEFWICLLLTVLGYIPGIIYAIYVLV 233 E E+I+AILLPP+GV R GC VEF ICL+LT+LGY+PGIIYAIYV+V Sbjct: 6 EILCEIIIAILLPPLGVCFRKGCCTVEFLICLVLTILGYVPGIIYAIYVIV 56
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: PMP3_GIBZE (Plasma membrane proteolipid 3 OS=Gibberella zeae GN=PMP3 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.389e-12 Identity = 30/46 (65.22%), Postives = 42/46 (91.30%), Query Frame = 3 Query: 96 EVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVLV 233 ++ILAI+LPPVGVFL GCG +F+I +LLT+LGYIPGII+A+Y+++ Sbjct: 20 KIILAIILPPVGVFLERGCGADFFINILLTILGYIPGIIHALYIIL 65
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: RC22_ARATH (UPF0057 membrane protein At2g24040 OS=Arabidopsis thaliana GN=At2g24040 PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.369e-12 Identity = 34/50 (68.00%), Postives = 41/50 (82.00%), Query Frame = 3 Query: 84 ETFLEVILAILLPPVGVFLRYGC-GVEFWICLLLTVLGYIPGIIYAIYVL 230 E E+ +AILLPPVGV LR+GC VEF+ICL+LT LGY+PGIIYAIY + Sbjct: 6 ELCCEIFIAILLPPVGVCLRHGCCTVEFFICLILTCLGYLPGIIYAIYAI 55
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: PMP3_DEBHA (Plasma membrane proteolipid 3 OS=Debaryomyces hansenii GN=PMP3 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 9.001e-12 Identity = 28/46 (60.87%), Postives = 40/46 (86.96%), Query Frame = 3 Query: 96 EVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVLV 233 ++I+AI+LPP+GVFL GC FWI ++LT+LGYIPGII+A+YV++ Sbjct: 10 KIIIAIILPPLGVFLERGCASSFWINIVLTILGYIPGIIHALYVIL 55
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: PMP3_CRYNE (Plasma membrane proteolipid 3 OS=Cryptococcus neoformans GN=PMP3 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.420e-11 Identity = 28/46 (60.87%), Postives = 40/46 (86.96%), Query Frame = 3 Query: 96 EVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVLV 233 ++ILAI+LPP+GVFL GCG + I +LLT+LGYIPGII+A+Y+++ Sbjct: 10 KIILAIILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIIL 55
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: YCU3_CAEEL (UPF0057 membrane protein T23F2.3 OS=Caenorhabditis elegans GN=T23F2.3 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.834e-11 Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 3 Query: 102 ILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVLV 233 I A+LLPP+GVFL GC IC+LLT+LGYIPGIIYA YV++ Sbjct: 12 ICAVLLPPIGVFLEKGCDYHLAICILLTILGYIPGIIYACYVIL 55
BLAST of CX308548 vs. ExPASy Swiss-Prot
Match: Y567_PSEAE (UPF0057 membrane protein PA0567 OS=Pseudomonas aeruginosa GN=PA0567 PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.834e-11 Identity = 26/46 (56.52%), Postives = 40/46 (86.96%), Query Frame = 3 Query: 93 LEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIYVL 230 + +++AILLPP+GVFL+ G G FW+ +LLT+LGYIPGI++A+Y++ Sbjct: 4 IRILIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVHAVYII 49 The following BLAST results are available for this feature:
BLAST of CX308548 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 18
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX308548 ID=CX308548; Name=CX308548; organism=Citrus clementina; type=EST; length=426bpback to top |