CX308728
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX308728 vs. ExPASy Swiss-Prot
Match: WRK74_ARATH (Probable WRKY transcription factor 74 OS=Arabidopsis thaliana GN=WRKY74 PE=1 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.652e-11 Identity = 29/55 (52.73%), Postives = 37/55 (67.27%), Query Frame = -3 Query: 52 QKVTKDNPSPRAYFRCSMASSGCPVKKKVQRCMEDKSFLVATYEGEHNHDVQCSS 216 QK K +P PR Y++CS GCP +K V+RC+E+ S L+ TYEGEHNH SS Sbjct: 272 QKPIKGSPHPRGYYKCSSVR-GCPARKHVERCVEETSMLIVTYEGEHNHSRILSS 325
BLAST of CX308728 vs. ExPASy Swiss-Prot
Match: WRK36_ARATH (Probable WRKY transcription factor 36 OS=Arabidopsis thaliana GN=WRKY36 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.652e-11 Identity = 38/85 (44.71%), Postives = 51/85 (60.00%), Query Frame = -3 Query: 1 QKVTKDNPSPRAYFRCSMASSGCPVKKKVQRCMEDK-SFLVATYEGEHNHDV------------QCSSLGQSSSLTNYCSPKSSI 216 QK K NP PRAY+RCSM SS CPV+K+VQRC E++ S + TYEG H+H + +SL QS S ++ S +S+ Sbjct: 213 QKTAKTNPLPRAYYRCSM-SSNCPVRKQVQRCGEEETSAFMTTYEGNHDHPLPMEASHMAAGTSAAASLLQSGSSSSSSSTSASL 296 The following BLAST results are available for this feature:
BLAST of CX308728 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX308728 ID=CX308728; Name=CX308728; organism=Citrus clementina; type=EST; length=218bpback to top |