CX309033
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX309033 vs. ExPASy Swiss-Prot
Match: PR4_PRUPE (Pathogenesis-related protein PR-4 (Fragment) OS=Prunus persica PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.952e-12 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = -1 Query: 202 GAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFANCND 351 GA+ VRIVDQC+NGGLDLD VF ++DTNG G QG L V+Y+F +C D Sbjct: 58 GAKVTVRIVDQCSNGGLDLDVNVFNQIDTNGQGNAQGHLIVNYDFVDCGD 107
BLAST of CX309033 vs. ExPASy Swiss-Prot
Match: HEVL_ARATH (Hevein-like protein OS=Arabidopsis thaliana GN=HEL PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.605e-11 Identity = 28/45 (62.22%), Postives = 36/45 (80.00%), Query Frame = -1 Query: 202 VRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFANCND 336 VRIVDQC+NGGLDLD +F ++DT+G GYQQG L V Y+F +C + Sbjct: 149 VRIVDQCSNGGLDLDVAMFNQIDTDGFGYQQGHLIVDYQFVDCGN 193 The following BLAST results are available for this feature:
BLAST of CX309033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX309033 ID=CX309033; Name=CX309033; organism=Citrus clementina; type=EST; length=351bpback to top |