DY258614

Overview
NameDY258614
Unique NameDY258614
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1278
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15308 contig Ccv1_Contig15308:169..1447. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY258614 vs. ExPASy Swiss-Prot
Match: NCASE_PSEAE (Neutral ceramidase OS=Pseudomonas aeruginosa GN=PA0845 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.756e-25
Identity = 73/210 (34.76%), Postives = 105/210 (50.00%), Query Frame = 2
Query:    2 RQFRKAVDLFNKASEKLEGKIDYRHSYLDFSQLEVTIPKQNGGSETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKGNPFWRLVRDLLKK-PDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVKTVVTTTGESNSNVHVVLAGLTNSYSQYVTTFEEYQVQRYEVSTWFIPPTCLSNY 628
            RQF KA ++  +A E++ G++D R  ++DF++L +     +G    + T                         ++  NPF   +  LL   P +E + CQ  K IL DTG  K+PY W P++LPIQ+ ++GQL +L  P EFT MAG R+R AV+      G      HVV  G  N+Y+ YVTT EEY  Q YE  +    P   + Y
Sbjct:  299 RQFAKAYEIAGQAQEEVLGELDSRFRFVDFTRLPIRPEFTDGQPRQLCTAAIGTSLAAGSTEDGPGPLGL----EEGNNPFLSALGGLLTGVPPQELVQCQAEKTILADTGN-KKPYPWTPTVLPIQMFRIGQLELLGAPAEFTVMAGVRIRRAVQAASEAAGIR----HVVFNGYANAYASYVTTREEYAAQEYEGGSTLYGPWTQAAY 499          
The following BLAST results are available for this feature:
BLAST of DY258614 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
NCASE_PSEAE1.756e-2534.76Neutral ceramidase OS=Pseudomonas aeruginosa GN=PA... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAI2CE08FM1 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258614 ID=DY258614; Name=DY258614; organism=Citrus clementina; type=EST; length=1278bp
GAGGCAATTTAGAAAAGCTGTAGATCTTTTCAATAAAGCATCCGAAAAAT
TAGAAGGAAAGATTGACTATCGTCACAGTTATCTGGACTTCTCCCAGCTT
GAGGTGACAATTCCTAAACAAAACGGAGGATCAGAGACAGTAAAAACATG
CCCTGCTGCTATGGGGTTTGCATTTGCTGCAGGAACAACGGATGGACCAG
GAGCATTTGATTTTACCCAAGGAGATGACAAGGGCAATCCTTTTTGGAGG
CTGGTACGCGACTTACTTAAAAAACCAGATAAGGAACAAATTAATTGTCA
GTACCCAAAGCCCATCTTACTCGATACTGGTGAAATGAAGCAACCATACG
ACTGGGCACCTTCAATACTTCCAATTCAGATCCTCCAAGTAGGGCAGCTA
GTCATTCTTAGTGTACCTGGAGAGTTTACAACAATGGCTGGGAGGCGACT
TCGTGATGCTGTGAAGACGGTGGTCACTACTACTGGTGAATCCAATAGCA
ATGTTCATGTTGTTTTAGCTGGCTTGACTAATTCCTATTCACAGTATGTG
ACTACCTTCGAAGAGTACCAGGTGCAGAGATACGAGGTCAGTACTTGGTT
TATACCACCAACATGCTTGAGTAATTATCTTCCACAATTGTCATAGCACT
AAGTACAACATACTCAATGAATTCATCAATTGCTCCATCTGCAAAAGTTA
TTATCTGTTATGACATACTTATCTTTCTCTCGGAGATGGAAGAATAGAAC
AAAGAACGGATTGTTGGCCGCATGCCAACGCCATACATATCTGGTTACCA
AAATACTTTTTTGCTGCCTCAGGGTGCCTCCACACTTTTATGGTCCACAC
ACGCTCAGTGCCTACATTTCAAGAGTTCAAGAAAGCTTGCAGGTGTTCCT
CTCAGTGGGCAACCTGTTGGATCGGGGCCACCAACCCCCGGATCTCCTGG
GACAAGCAGAAAAGCTTTCCTTAAACAAGTTGTGATGGACTCCCCGCCTA
TCGGTGGTCAATTTTGGGGATTGGCAAGTTCGAAGGTCCTTCAAACCCTA
CCTTTCAGGGAAAGGTGAAAAGGGTGAACGGTCCCCCTTCGGGTCACCTT
GGCCCGAAAAAATGAAATTCAAAAAAGTAAAGGAAAATTTTTCCCCCTTG
TTTTGAAATTCCCCCAGGGGAAAAAAAAAATTTTGGGGCCCCCCCCCTAT
TTAATGAAAAAAGAAAAAAAATTTTCCGCCCCCCTCTCTCCTCTTTTAAA
GGGGGGGGTGCCTCCCACCAAACCCCAC
back to top