DY258624

Overview
NameDY258624
Unique NameDY258624
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1280
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY258624_ssr132 microsatellite DY258624_ssr132:132..143. BLAST: Citrus ESTs to Prunus persica proteins V1
DY258624_ssr39 microsatellite DY258624_ssr39:39..50. BLAST: Citrus ESTs to Prunus persica proteins V1
DY258624_ssr781 microsatellite DY258624_ssr781:781..792. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11B_MOUSE (Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3)

HSP 1 Score: 291.197 bits (744), Expect = 8.902e-78
Identity = 142/192 (73.96%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK N  F+ETSAL+S NVE A   +LT+IYR+V+++ +  R      P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11B_HUMAN (Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4)

HSP 1 Score: 291.197 bits (744), Expect = 8.902e-78
Identity = 142/192 (73.96%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK N  F+ETSAL+S NVE A   +LT+IYR+V+++ +  R      P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11B_DISOM (Ras-related protein Rab-11B OS=Discopyge ommata PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 8.902e-78
Identity = 141/192 (73.44%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH D+NIVIMLVGNK+DLRHLRAV T++A++FAEK N  F+ETSAL+S NVE A   +LT+IYR+V+++ +  R      P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQISDRSAHDESPGNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11B_BOVIN (Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3)

HSP 1 Score: 291.197 bits (744), Expect = 8.902e-78
Identity = 142/192 (73.96%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK N  F+ETSAL+S NVE A   +LT+IYR+V+++ +  R      P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_RAT (Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 1.518e-77
Identity = 141/192 (73.44%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK    F+ETSAL+S NVE A   +LT+IYR+V+++ +  R +    P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_RABIT (Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 1.518e-77
Identity = 141/192 (73.44%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK    F+ETSAL+S NVE A   +LT+IYR+V+++ +  R +    P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_PONAB (Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 1.518e-77
Identity = 141/192 (73.44%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK    F+ETSAL+S NVE A   +LT+IYR+V+++ +  R +    P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_PIG (Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 1.518e-77
Identity = 141/192 (73.44%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK    F+ETSAL+S NVE A   +LT+IYR+V+++ +  R +    P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_MOUSE (Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 1.518e-77
Identity = 141/192 (73.44%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK    F+ETSAL+S NVE A   +LT+IYR+V+++ +  R +    P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_HUMAN (Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 1.518e-77
Identity = 141/192 (73.44%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK    F+ETSAL+S NVE A   +LT+IYR+V+++ +  R +    P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVV 196          
The following BLAST results are available for this feature:
BLAST of DY258624 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RB11B_MOUSE8.902e-7873.96Ras-related protein Rab-11B OS=Mus musculus GN=Rab... [more]
RB11B_HUMAN8.902e-7873.96Ras-related protein Rab-11B OS=Homo sapiens GN=RAB... [more]
RB11B_DISOM8.902e-7873.44Ras-related protein Rab-11B OS=Discopyge ommata PE... [more]
RB11B_BOVIN8.902e-7873.96Ras-related protein Rab-11B OS=Bos taurus GN=RAB11... [more]
RB11A_RAT1.518e-7773.44Ras-related protein Rab-11A OS=Rattus norvegicus G... [more]
RB11A_RABIT1.518e-7773.44Ras-related protein Rab-11A OS=Oryctolagus cunicul... [more]
RB11A_PONAB1.518e-7773.44Ras-related protein Rab-11A OS=Pongo abelii GN=RAB... [more]
RB11A_PIG1.518e-7773.44Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11... [more]
RB11A_MOUSE1.518e-7773.44Ras-related protein Rab-11A OS=Mus musculus GN=Rab... [more]
RB11A_HUMAN1.518e-7773.44Ras-related protein Rab-11A OS=Homo sapiens GN=RAB... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAI2CG06FM1 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258624 ID=DY258624; Name=DY258624; organism=Citrus clementina; type=EST; length=1280bp
CCCTTCTTAATTTGCAATGTTAATAACATTACTCAAACAAGAAGAAGAAG
AATAGCGAAAGCCTTAGATTTTCTTCATCTGTTCCCATCATCAACTTCAC
CTCACCTGTCTTGCACACACACTCACACTTATCTCTCTCTCTCTATTGCG
TTAATTGCATAATACACAATTCAATAAGAGAGGAGGGGAAAAAAAAAAGA
AGAAAGAAATTGAAAAAAATGGGAGCATACAGAGCTGACGACGACTACGA
TTACTTGTTCAAGGTGGTGTTAATTGGAGATTCAGGAGTTGGGAAATCAA
ATCTGTTATCTCGATTCACCAAGAACGAATTCAGCCTCGAATCGAAATCC
ACCATCGGCGTCGAATTCGCCACTCGCAGCATTCGCGTCGACGACAAGGT
CGTCAAGGCTCAGATTTGGGACACCGCCGGCCAAGAACGATATCGTGCTA
TCACAAGTGCGTACTACCGGGGAGCTGTTGGTGCCTTGCTTGTCTATGAT
GTCACCCGACATGTTACTTTTGAGAATGTTGAGAGATGGTTGAAAGAGCT
TCGGGATCACACAGACTCAAACATTGTGATAATGCTTGTGGGTAACAAGG
CTGATTTGCGTCACTTGCGTGCTGTTTCAACTGAGGATGCTCAGTCGTTC
GCTGAGAAAGAGAACACTTTCTTCATGGAAACCTCTGCCCTAGAGTCGTT
GAATGTTGAAAATGCCCTCCCCGAAGTGCTCACTCAGATATATCGAGTTG
TTAACAGGGAGGCTCTTGAGGTAAGGGATGACCCACCCACCCTGCCCAAG
GGTCAAATTATTATATTGGTACAAAAGATAATGTATCGGCTGTGAAAAAA
ACTGGGTGCTGCTCCTGCATATCCTGCCACCTTCCAAGGAAAATCCCGGG
GGCTAAAAAAAAGTTTCCCCTCTTTTTAAAAATTTAACTTTCCCTTGGTT
TGGAAAAACTCTTGGGTTTTAACTTGGCTGCCCGGAAAAAAAAAAACATG
GGAGGTGCAGGAAAAAAATTTAAGTTTTTACATTTTTCACTCGGGACCCG
GGAAATCTCCCAAATCCTGGGTTGGAAATATAGGGTAAAAAGCCAAAAAT
CTTTTTGGGAATTGGAAAACCCTCCGGGTTTGGTGGGAAGAACCCCACAC
GGTTTTTTTTTTCTTTTTTTGGTGTATTGTCCCTCTTTTGTTTTGTCCCC
CCCCAAAAAAAAAAAATTGGTGAAAAAAAAGTTGTTTTACCCACCCCCCC
CCCCAAAAAACACCCTCCCCAAAAAGAGAA
back to top