DY258641
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY258641 vs. ExPASy Swiss-Prot
Match: VATA_METBF (V-type ATP synthase alpha chain OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=atpA PE=3 SV=1) HSP 1 Score: 44.669 bits (104), Expect = 9.201e-11 Identity = 22/43 (51.16%), Postives = 29/43 (67.44%), Query Frame = 2 Query: 383 FINRGYNVSMMEDSTSRW*EALSKISRRLAKMPAYNEYHEFLS 511 F + G +VS+M DSTSRW EA+ +IS RL +MP Y +LS Sbjct: 313 FRDMGLDVSLMADSTSRWAEAMREISSRLEEMPGEEGYPAYLS 355 HSP 2 Score: 43.8986 bits (102), Expect = 9.201e-11 Identity = 27/68 (39.71%), Postives = 38/68 (55.88%), Query Frame = 3 Query: 513 ARLASIYKRAGKVKCLGAPKRTGIVTIVGAVSPPEREFSKTVTSCQPPH*ASPI*G*EKKNTQKKHFP 716 ARLA Y+RAG + L TG +T++GAVSPP +FS+ VT + K +Q++HFP Sbjct: 356 ARLAEFYERAGVAESLCG--ETGSITVIGAVSPPGGDFSEPVTQ-NTLRIVKVFWALDAKLSQRRHFP 420 The following BLAST results are available for this feature:
BLAST of DY258641 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 121
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DY258641 ID=DY258641; Name=DY258641; organism=Citrus clementina; type=EST; length=1314bpback to top |