DY259745

Overview
NameDY259745
Unique NameDY259745
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1023
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI3_SOLTU (Endochitinase 3 (Fragment) OS=Solanum tuberosum GN=CHTB3 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 4.722e-52
Identity = 114/246 (46.34%), Postives = 142/246 (57.72%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARG-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAG-------FPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            CG G  C  +  G     G+LG +IS  MF+ +L +RND  C  +  FY+Y+AFI AA +FP FG +G+ T RKREIAAF AQT  ETTGGWP AP G YAWGYC++R+   P  DYC      PC    +Y+GRGPIQ++ N NY  CG A+G                SFKSAIWFWMT  PQS + +      G  Q     P+G        PG+G+ TNII+GG+ECG G +  V   IGF
Sbjct:   49 CGPGN-CQSQCPGGPGPSGDLGGVISNSMFDQMLNHRNDNACQGKNNFYSYNAFISAAGSFPGFGTTGDITARKREIAAFLAQTSHETTGGWPSAPDGPYAWGYCFLREQGSP-GDYCTPSSQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDSVISFKSAIWFWMT--PQSPKPSCHDVITGRWQ-----PSGADQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGF 285          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI2_SOLTU (Endochitinase 2 (Fragment) OS=Solanum tuberosum GN=CHTB2 PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 6.167e-52
Identity = 110/229 (48.03%), Postives = 135/229 (58.95%), Query Frame = 1
Query:  124 GTDGGELGKIISREMFEDLLPYRNDVRCPARG-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRA-TKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            G   G+LG +IS  MF+ +L +RND  C  +G FY+Y+AFI AA +FP FG +G+ T RKREIAAFFAQT  ETTGGW  AP G YAWGYC++R+   P  DYC      PC    +Y+GRGPIQ++ N NY  CG A+G                SFKSAIWFWMT Q   P  H   T     +G  Q         PG+G+ TNII+GG+ECG G +  V   IGF
Sbjct:   60 GGSPGDLGGVISNSMFDQMLNHRNDNACQGKGNFYSYNAFISAAGSFPGFGTTGDITARKREIAAFFAQTSHETTGGWASAPDGPYAWGYCFLREQGSP-GDYCTPSNQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDSIISFKSAIWFWMTPQSPKPSCHDVITGRWQPSGTDQAAN----RVPGFGVITNIINGGLECGHGSDSRVQDRIGF 283          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIC_SOLLC (Basic 30 kDa endochitinase OS=Solanum lycopersicum GN=CHI9 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 1.052e-51
Identity = 113/246 (45.93%), Postives = 142/246 (57.72%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARG-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAG-------FPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            CG G  C  +  G     G+LG +IS  MF+ +L +RND  C  +  FY+Y+AF+ AA +FP FG +G+ T RKREIAAF AQT  ETTGGWP AP G YAWGYC++R+   P  DYC      PC    +Y+GRGPIQ++ N NY  CG A+G                SFKSAIWFWMT  PQS + +      G  Q     P+G        PG+G+ TNII+GG+ECG G +  V   IGF
Sbjct:   53 CGPGN-CQSQCPGGPGPSGDLGGVISNSMFDQMLNHRNDNACQGKNNFYSYNAFVTAAGSFPGFGTTGDITARKREIAAFLAQTSHETTGGWPTAPDGPYAWGYCFLREQGSP-GDYCTPSSQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSAIWFWMT--PQSPKPSCHDVITGRWQ-----PSGADQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGF 289          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIX_PEA (Endochitinase OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.794e-51
Identity = 97/221 (43.89%), Postives = 131/221 (59.28%), Query Frame = 1
Query:  127 TDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            T GG++G+++   +F+ +L YRND RC   GFYTYDAFI AA++F  FG +G++  +K+E+AAF AQT  ETTGGWP AP G YAWGYC++ + +        +  PC    +YYGRGPIQLT N NY   G+A+                 SFK+AIWFWMT Q     +   ++          +    PGYG+ TNII+GGIECG G ++ V   +GF
Sbjct:   75 TGGGDVGRLVPSSLFDQMLKYRNDGRCAGHGFYTYDAFIAAARSFNGFGTTGDDNTKKKELAAFLAQTSHETTGGWPTAPDGPYAWGYCFVSEQNTQEVYCSPKDWPCAPGKKYYGRGPIQLTHNYNYGLAGQAIKEDLINNPDLLSTNPTVSFKTAIWFWMTPQANKPSSHDVITGRWTPSAADSSAGRVPGYGVITNIINGGIECGHGQDNRVDDRVGF 295          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI2_HORVU (26 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 2.344e-51
Identity = 104/224 (46.43%), Postives = 131/224 (58.48%), Query Frame = 1
Query:  124 GTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            GT  G +  I+SR  F+ +L +RND  C A+GFYTYDAF+ AA AFP FG +G+   +KRE+AAF AQT  ETTGGW  AP G +AWGYC+ +Q    +SDYC      PC    +YYGRGPIQL+ N NY   G A+G                 FK+AIWFWMTAQP    +   ++   +           PG+G+ TNII+GGIECG G +  V   IGF
Sbjct:   19 GTARGSVSSIVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAAAAFPGFGTTGSADAQKREVAAFLAQTSHETTGGWATAPDGAFAWGYCF-KQERGASSDYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLANPDLVATDATVGFKTAIWFWMTAQPPKPSSHAVIAGQWSPSGADRAAGRVPGFGVITNIINGGIECGHGQDSRVADRIGF 241          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI3_ORYSJ (Chitinase 3 OS=Oryza sativa subsp. japonica GN=Cht3 PE=2 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 3.061e-51
Identity = 109/247 (44.13%), Postives = 134/247 (54.25%), Query Frame = 1
Query:   67 GSAQNCGSGVVCGERDTGHGTDGGE-LGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            G    C  G  CG   T   + GG  +  IIS  +F+ +L +RND  C A+GFYTYDAF+ AA A+P F  +G+    KRE+AAF AQT  ETTGGWP AP G Y+WGYC+  + +  A  YC      PC    +YYGRGPIQ+T+N NY   G+A+G                SFK+A WFWMT Q   P  H       T     Q        PGYG  TNII+GG+ECG G +D V   IGF
Sbjct:   52 GCQSQCSGG--CGGGPTPPSSGGGSGVASIISPSLFDQMLLHRNDQACAAKGFYTYDAFVAAANAYPDFATTGDADTCKREVAAFLAQTSHETTGGWPTAPDGPYSWGYCFKEENNGNAPTYCEPKPEWPCAAGKKYYGRGPIQITYNYNYGPAGQAIGSDLLNNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVITGQWTPSADDQ---AAGRVPGYGEITNIINGGVECGHGADDKVADRIGF 293          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI1_HORVU (26 kDa endochitinase 1 OS=Hordeum vulgare PE=2 SV=4)

HSP 1 Score: 201.06 bits (510), Expect = 8.906e-51
Identity = 114/257 (44.36%), Postives = 142/257 (55.25%), Query Frame = 1
Query:   67 GSAQNCGSGVVCGERDTGHG----------TDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRA-TKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            GS   CG G  C  + +G G          + GG +  I+SR +F+ +L +RND  C A+GFYTYDAF+ AA AF  FG +G    RKRE+AAF AQT  ETTGGW  AP G +AWGYC+ +Q     S+YC      PC     YYGRGPIQL+ N NY   G A+G                SFK+A+WFWMTAQ   P SH   T   S +G  +         PG+G+ TNI++GGIECG G +  V   IGF
Sbjct:   44 GSTPYCGDG--CQSQCSGCGGGSTPVTPTPSGGGGVSSIVSRALFDRMLLHRNDGACQAKGFYTYDAFVAAASAFRGFGTTGGTDTRKREVAAFLAQTSHETTGGWATAPDGAFAWGYCF-KQERGATSNYCTPSAQWPCAPGKSYYGRGPIQLSHNYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMTAQAPKPSSHAVITGQWSPSGTDR----AAGRVPGFGVITNIVNGGIECGHGQDSRVADRIGF 293          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIA_SECCE (Basic endochitinase A OS=Secale cereale GN=rsca PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.163e-50
Identity = 107/225 (47.56%), Postives = 133/225 (59.11%), Query Frame = 1
Query:  133 GGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRA-TKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            GG +  I+SR +F+ +L +RND  C A+GFYTYDAF+ AA AFP FG +G+   RKRE+AAF AQT  ETTGGW  AP G +AWGYC+ +Q     S+YC      PC     YYGRGPIQL+ N NY   G A+G                SFK+A+WFWMTAQ   P SH   T   S +G  +         PG+G+ TNI++GGIECG G +  V   IGF
Sbjct:   77 GGGVSSIVSRALFDRMLLHRNDGACQAKGFYTYDAFVAAAGAFPGFGTTGSTDTRKREVAAFLAQTSHETTGGWATAPDGAFAWGYCF-KQERGATSNYCTPSAQWPCAPGKSYYGRGPIQLSHNYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMTAQAPKPSSHAVITGQWSPSGTDR----AAGRVPGFGVITNIVNGGIECGHGQDSRVADRIGF 296          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIC_SECCE (Basic endochitinase C OS=Secale cereale GN=rscc PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.984e-50
Identity = 108/228 (47.37%), Postives = 134/228 (58.77%), Query Frame = 1
Query:  124 GTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRA-TKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            GT  G +  IIS   F+ +L +RND  C A+GFYTYDAF+ AA AFP FG +G+   RKR++AAF AQT  ETTGGW  AP G +AWGYC+ +Q    A+DYC      PC    +YYGRGPIQL+ N NY   G A+G                SFK+A+WFWMTAQ   P SH   T   S +G  +         PG+G+ TNII+GG+ECG G +  V   IGF
Sbjct:   19 GTAHGSVSSIISHAQFDRMLLHRNDGACQAKGFYTYDAFVAAANAFPGFGATGSTDARKRDVAAFLAQTSHETTGGWATAPDGAFAWGYCF-KQERGAAADYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTALWFWMTAQAPKPSSHAVITGKWSPSGADR----AAGRAPGFGVITNIINGGLECGHGQDSRVADRIGF 241          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI12_ORYSJ (Chitinase 12 OS=Oryza sativa subsp. japonica GN=Cht12 PE=2 SV=2)

HSP 1 Score: 199.134 bits (505), Expect = 3.384e-50
Identity = 109/247 (44.13%), Postives = 133/247 (53.85%), Query Frame = 1
Query:   70 SAQNCGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNET-MRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPAS-DYCYRYC--PCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            SA  CG G          G+ G  +  I+SR +F+ +L +RND  CPA  FYTYDAF+ AA AFP F  +G +    KRE+AAF AQT  ETTGGW  AP G YAWGYC+  +    A  DYC +    PC    +YYGRGPIQL++N NY   G+A+G                SF +A WFWMT Q   P  H       T     Q        PGYG+ TNII+GG+ECG G +D V   IGF
Sbjct:   61 SAAGCGGG----GPTPPSGSGGSGVASIVSRSLFDQMLLHRNDAACPASNFYTYDAFVAAASAFPGFAAAGGDADTNKREVAAFLAQTSHETTGGWATAPDGPYAWGYCFKEENGGAAGPDYCQQSAQWPCAAGKKYYGRGPIQLSYNFNYGPAGQAIGADLLGDPDLVASDATVSFDTAFWFWMTPQSPKPSCHAVATGQWTPSADDQ---AAGRVPGYGVITNIINGGLECGHGEDDRVADRIGF 300          
The following BLAST results are available for this feature:
BLAST of DY259745 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHI3_SOLTU4.722e-5246.34Endochitinase 3 (Fragment) OS=Solanum tuberosum GN... [more]
CHI2_SOLTU6.167e-5248.03Endochitinase 2 (Fragment) OS=Solanum tuberosum GN... [more]
CHIC_SOLLC1.052e-5145.93Basic 30 kDa endochitinase OS=Solanum lycopersicum... [more]
CHIX_PEA1.794e-5143.89Endochitinase OS=Pisum sativum PE=2 SV=1[more]
CHI2_HORVU2.344e-5146.4326 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=... [more]
CHI3_ORYSJ3.061e-5144.13Chitinase 3 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI1_HORVU8.906e-5144.3626 kDa endochitinase 1 OS=Hordeum vulgare PE=2 SV=... [more]
CHIA_SECCE1.163e-5047.56Basic endochitinase A OS=Secale cereale GN=rsca PE... [more]
CHIC_SECCE1.984e-5047.37Basic endochitinase C OS=Secale cereale GN=rscc PE... [more]
CHI12_ORYSJ3.384e-5044.13Chitinase 12 OS=Oryza sativa subsp. japonica GN=Ch... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB02FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259745 ID=DY259745|Name=DY259745|organism=Citrus clementina|type=EST|length=1023bp
GCTTTCAAAATGAGGCTCATTGGGTCCTTACTAATTTTCTCTCTAGTTTT
ATCTTTTGTACTAGGAGGTTCAGCACAGAATTGTGGAAGCGGCGTTGTGT
GCGGTGAACGTGATACTGGCCACGGGACGGATGGCGGTGAACTGGGCAAG
ATCATCTCAAGGGAGATGTTTGAAGACTTGCTTCCGTATAGAAATGATGT
ACGATGCCCTGCCAGAGGCTTCTACACTTACGATGCTTTTATAGAGGCAG
CCAAAGCTTTTCCAGCCTTTGGTAACTCTGGAAATGAAACCATGCGTAAA
AGAGAAATTGCTGCCTTTTTTGCCCAAACTGGCGATGAAACTACTGGGGG
ATGGCCCGATGCACCTGGTGGAGAATATGCTTGGGGATATTGCTATATTA
GGCAAGTTAGCCGCCCTGCGTCCGACTACTGTTATCGTTACTGTCCATGT
CCTTTGCCAGGGCAATACTATGGCCGAGGTCCAATTCAACTCACTTGGAA
TTGCAATTACTTAAGGTGCGGAGAAGCCTTGGGGGTGGACTTGTTGAACA
ATCCAGACCTTCTTGCCCCTGATCCAGTACTATCATTCAAGTCAGCAATC
TGGTTCTGGATGACTGCACAGCCCCAAAGCCATCGTGCCACGAAGTCATT
ATCGACGAATGGAAACCATCAGCAATTGAAGTAAACGCCCGCCGGCTTCC
CGGGATACGGTCTAACCACAAATATAATCCACGGTGGAATTGAATGTGGC
CAAGGTGGGAATGACCCTGTACCCACCCCTATTGGGTTCCTTACCCCTTT
TCGGTGGCAAGTTGGGGATTCGGCCCGGTGACCACCCTGATTGCCACACC
CACGGCCCTAAGGGCCTAACCGAAGGGCCCATTCCTAGTGATCCCCCTGA
TCCAGGTTTTAATAAATAAACCCTAATAAAAACCCACCTAAAAAAAACTT
TTAAATGGCCCAGTTGGTAGGGGGGCAACTAAATTTTTTCCTTTGGTTCC
CCCCTTATTGCAAGTAAAATAAA
back to top