DY259745

Overview
NameDY259745
Unique NameDY259745
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1023
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHID_SOLLC (Basic endochitinase (Fragment) OS=Solanum lycopersicum GN=CHI14 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.286e-49
Identity = 98/218 (44.95%), Postives = 128/218 (58.72%), Query Frame = 1
Query:  142 LGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            +  +IS+ +FE +L +RND  C A+GFYTY+AFI A K F AFG +G+   R +EIAAF AQT  ETTGGW  AP G Y+WGYCY R+   P  DYC   +  PC    +Y+GRGPIQ+++N NY   G A+G                SFK+A+WFWMTAQ     A   ++   +       P   PG+G+ TNII+GG+EC  G N  +   IGF
Sbjct:    5 ISSLISKNLFERILVHRNDRACGAKGFYTYEAFITATKTFAAFGTTGDTNTRNKEIAAFLAQTSHETTGGWATAPDGPYSWGYCYNREQGSP-GDYCASSQQWPCAPGKKYFGRGPIQISYNYNYGAAGSAIGVNLLNNPDLVANDAVVSFKTALWFWMTAQQPKPSAHDVITGRWSPSVADSAPGRVPGFGVITNIINGGMECNSGSNALMDNRIGF 221          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIB_SOLLC (Acidic 27 kDa endochitinase OS=Solanum lycopersicum GN=CHI17 PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.471e-45
Identity = 98/222 (44.14%), Postives = 129/222 (58.11%), Query Frame = 1
Query:  124 GTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            G+   ++G I++ ++F ++L  RND RCPA+GFYTYDAFI AA +FP FG +G++T RK+EIAAFF QT  ETTGG   A  G +A GYC++R+ ++  S              +YGRGPIQLT   NY   G+A+G                SFK+AIWFWMTAQ         ++          +    PGYG+ TNII+GGIECG+G N  V   IGF
Sbjct:   13 GSFAQDVGTIVTSDLFNEMLKNRNDDRCPAKGFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETTGGSLSA-DGPFAGGYCFVREGNQMGSG-------------FYGRGPIQLTGQSNYDLAGQAIGQDLVNNPDLVATDATVSFKTAIWFWMTAQGNKPSCHDVITGQWTPSAADASANRQPGYGVITNIINGGIECGKGQNPQVEDRIGF 220          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI11_ORYSJ (Chitinase 11 OS=Oryza sativa subsp. japonica GN=Cht11 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 4.733e-44
Identity = 95/209 (45.45%), Postives = 121/209 (57.89%), Query Frame = 1
Query:  142 LGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRA-TKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQG 756
            +G II+R MFE +L +R D  C    FYTYDAFI+AA  FP FG +GN+  R+RE+AAFF QT  ETTGGW  AP G +AWGYC + +++             P    YYGRGPIQLT   NY   G+ALG                +F++AIWFWMTAQ   P  H   T   + +G+ +    +    PGYG+ TNII+GG ECG+G
Sbjct:   27 VGSIITRAMFESMLSHRGDQGCQG-AFYTYDAFIKAAGDFPRFGTTGNDETRRRELAAFFGQTSHETTGGWATAPDGPFAWGYCRVNEIT-------------PSDPPYYGRGPIQLTHKYNYQLAGDALGLDLVNNPDLVSSDPVVAFRTAIWFWMTAQSPKPSCHDVITNQWTPSGDDR----SSGRLPGYGMATNIINGGEECGKG 217          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIA_SOLCI (Acidic endochitinase pcht28 OS=Solanum chilense PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 6.182e-44
Identity = 97/224 (43.30%), Postives = 124/224 (55.36%), Query Frame = 1
Query:  124 GTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEAL--GXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            GT     G I++RE+FE +L +RN+  CPA+GFYTYDAFI AA +FP FG +G++T RK+EIAAFF QT  ET GG      G +  GYC++RQ+ +  SD            +YYGRGPIQLT   NY R G+ +  G                SF++AIWFWMTAQ         +                PGYG+ TNII+GG+EC  G N  V + IGF
Sbjct:   21 GTLAQNAGSIVTRELFEQMLSFRNNDACPAKGFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETKGG----SAGTFTGGYCFVRQIDQ--SD------------RYYGRGPIQLTHQSNYERAGQGIGVGQDLVNNPDLVATDPIISFRTAIWFWMTAQDNKPSCHNVIIGQWTPSPADTAANRVPGYGVITNIINGGLECNMGPNTAVESRIGF 226          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI10_ORYSJ (Chitinase 10 OS=Oryza sativa subsp. japonica GN=Cht10 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 6.182e-44
Identity = 93/230 (40.43%), Postives = 125/230 (54.35%), Query Frame = 1
Query:  118 GHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC---YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMT---AQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            G+      +  I+S +++  L  +++D  CPARGFYTY +F+ AA  FP F  +G    RKRE+AAF AQ   ETTGGW  AP G YAWG CY  +++ P S YC    +  PC     Y+GRGPIQ++WN NY   G+ALG                +F++A+WFWMT    +P  H+        G         AGF   GL TNI++GG+EC + G+  V   IGF
Sbjct:   41 GYSPSPSPVSSIVSEQLYASLFLHKDDAACPARGFYTYASFVRAATRFPRFAATGCADARKREVAAFLAQISHETTGGWATAPDGPYAWGLCYKEEIN-PQSSYCDATDKQWPCYPGKSYHGRGPIQISWNFNYGPAGQALGFDGLRNPEIVANCSDIAFQTALWFWMTPRDTKPSCHQVMVGEYRPGPADVAANRTAGF---GLVTNIVNGGLECNRAGDARVNNRIGF 266          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIQ_TOBAC (Acidic endochitinase Q OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.054e-43
Identity = 101/219 (46.12%), Postives = 124/219 (56.62%), Query Frame = 1
Query:  142 LGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            +G I++ ++F ++L  RND RCPA GFYTYDAFI AA +FP FG +G++T R++EIAAFF QT  ETTGG   A    +  GYC++RQ     SD            +YYGRGPIQLT   NY + G A+G                SFK+AIWFWMT Q   P SH       T     Q        PGYG+ TNII+GGIECG G ND V   IG+
Sbjct:   27 IGSIVTSDLFNEMLKNRNDGRCPANGFYTYDAFIAAANSFPGFGTTGDDTARRKEIAAFFGQTSHETTGGSLSAE--PFTGGYCFVRQ--NDQSD------------RYYGRGPIQLTNRNNYEKAGTAIGQELVNNPDLVATDATISFKTAIWFWMTPQDNKPSSHDVIIGRWTPSAADQ---AANRVPGYGVITNIINGGIECGIGRNDAVEDRIGY 226          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIA_SOLLC (Acidic 26 kDa endochitinase OS=Solanum lycopersicum GN=CHI3 PE=1 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.523e-42
Identity = 101/228 (44.30%), Postives = 126/228 (55.26%), Query Frame = 1
Query:  124 GTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEAL--GXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAG-FPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            GT     G I++RE+FE +L +RN+  CPA+GFYTYDAFI AA +FP FG +G++T RK+EIAAFF QT  ET GG      G +  GYC+++Q+ +  SD            +YYGRGPIQLT   NY R G+ +  G                SFK+AIWFWMT Q   P  H       T       K T A   PGYG+ TNII+G  ECG G N    + IGF
Sbjct:   21 GTLAQNAGSIVTRELFEQMLSFRNNDACPAKGFYTYDAFIAAANSFPGFGTAGDDTARKKEIAAFFGQTSHETNGG----SAGTFTGGYCFVKQIEQ--SD------------RYYGRGPIQLTHQSNYERAGQGIGVGQELVNNPDLVATDPIISFKTAIWFWMTEQDNKPSCHNVIIGQWT----PSPKDTAANRVPGYGVITNIINGQFECGMGPNTAAESRIGF 226          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI8_ORYSJ (Chitinase 8 OS=Oryza sativa subsp. japonica GN=Cht8 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.523e-42
Identity = 102/241 (42.32%), Postives = 129/241 (53.53%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNET-MRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAG-FPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            C +  +     +G    G  +G +I++ +F  +LP R++ +CPARGFYTYDAFI AA +FPAFG SG    + +RE+AAFF QT  ETTGG       ++ WGYC+  ++++  S              YYGRGPIQLT   NY   G ALG                SFK+AIWFWMTAQ   P  H       T         T AG  PGYG+ TNII+GGIECG G ND     IG+
Sbjct:   14 CAAASLLAVAASGAAAQG--VGSVITQAVFNSMLPNRDNSQCPARGFYTYDAFIAAANSFPAFGTSGGSAELIRRELAAFFGQTSHETTGG-TRGSSDQFQWGYCFKEEINKATSP------------PYYGRGPIQLTGQSNYQAAGNALGLDLVGNPDLVSTDAVVSFKTAIWFWMTAQGNKPSCHDVILGRWTPSAAD----TAAGRVPGYGVITNIINGGIECGVGQNDANVDRIGY 235          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIT_PETHY (Acidic endochitinase OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.989e-42
Identity = 95/222 (42.79%), Postives = 124/222 (55.86%), Query Frame = 1
Query:  124 GTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            GT    +G I++ ++F+ +L  RND RC A  FYTYDAFI AA +FP FG +G++T RK+EIAAFF QT  ETTGG   +P G YA GYC++R+ ++             +   YYGRGPIQLT   NY   G+A+                 SFK+AIWFWMT Q         ++          +    PGYG+ TNII+GGIECG+G N  V   IG+
Sbjct:   20 GTLAQNVGSIVTSDLFDQMLKNRNDARCFAVRFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETTGG-TLSPDGPYAGGYCFLREGNQ-------------MGNGYYGRGPIQLTGQSNYDLAGKAIEQDLVNNPDLVATDATVSFKTAIWFWMTPQGNKPSCHDVITGRWTPSAADTSANRVPGYGVITNIINGGIECGKGQNARVEDRIGY 227          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIP_TOBAC (Acidic endochitinase P OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.683e-41
Identity = 99/219 (45.21%), Postives = 122/219 (55.71%), Query Frame = 1
Query:  142 LGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            +G I++ ++F ++L  RND RCPA GFYTYDAFI AA +FP FG SG++T R++EIAAFF QT  ETTGG   A    +  GYC++RQ     SD            +YYGRGPIQLT   NY + G A+                 SFK+AIWFWMT Q   P SH       T     Q   +    PG G+ TNII+GGIECG G N  V   IG+
Sbjct:   27 IGSIVTNDLFNEMLKNRNDGRCPANGFYTYDAFIAAANSFPGFGTSGDDTARRKEIAAFFGQTSHETTGGSLSAE--PFTGGYCFVRQ--NDQSD------------RYYGRGPIQLTNQNNYEKAGNAIRQDLVNNPDLVATDATISFKTAIWFWMTPQDNKPSSHDVIIGSWTPSAADQ---SANRAPGCGVITNIINGGIECGVGPNAAVEDRIGY 226          
The following BLAST results are available for this feature:
BLAST of DY259745 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHID_SOLLC1.286e-4944.95Basic endochitinase (Fragment) OS=Solanum lycopers... [more]
CHIB_SOLLC1.471e-4544.14Acidic 27 kDa endochitinase OS=Solanum lycopersicu... [more]
CHI11_ORYSJ4.733e-4445.45Chitinase 11 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHIA_SOLCI6.182e-4443.30Acidic endochitinase pcht28 OS=Solanum chilense PE... [more]
CHI10_ORYSJ6.182e-4440.43Chitinase 10 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHIQ_TOBAC1.054e-4346.12Acidic endochitinase Q OS=Nicotiana tabacum PE=1 S... [more]
CHIA_SOLLC1.523e-4244.30Acidic 26 kDa endochitinase OS=Solanum lycopersicu... [more]
CHI8_ORYSJ1.523e-4242.32Chitinase 8 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIT_PETHY1.989e-4242.79Acidic endochitinase OS=Petunia hybrida PE=2 SV=1[more]
CHIP_TOBAC1.683e-4145.21Acidic endochitinase P OS=Nicotiana tabacum PE=1 S... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB02FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259745 ID=DY259745|Name=DY259745|organism=Citrus clementina|type=EST|length=1023bp
GCTTTCAAAATGAGGCTCATTGGGTCCTTACTAATTTTCTCTCTAGTTTT
ATCTTTTGTACTAGGAGGTTCAGCACAGAATTGTGGAAGCGGCGTTGTGT
GCGGTGAACGTGATACTGGCCACGGGACGGATGGCGGTGAACTGGGCAAG
ATCATCTCAAGGGAGATGTTTGAAGACTTGCTTCCGTATAGAAATGATGT
ACGATGCCCTGCCAGAGGCTTCTACACTTACGATGCTTTTATAGAGGCAG
CCAAAGCTTTTCCAGCCTTTGGTAACTCTGGAAATGAAACCATGCGTAAA
AGAGAAATTGCTGCCTTTTTTGCCCAAACTGGCGATGAAACTACTGGGGG
ATGGCCCGATGCACCTGGTGGAGAATATGCTTGGGGATATTGCTATATTA
GGCAAGTTAGCCGCCCTGCGTCCGACTACTGTTATCGTTACTGTCCATGT
CCTTTGCCAGGGCAATACTATGGCCGAGGTCCAATTCAACTCACTTGGAA
TTGCAATTACTTAAGGTGCGGAGAAGCCTTGGGGGTGGACTTGTTGAACA
ATCCAGACCTTCTTGCCCCTGATCCAGTACTATCATTCAAGTCAGCAATC
TGGTTCTGGATGACTGCACAGCCCCAAAGCCATCGTGCCACGAAGTCATT
ATCGACGAATGGAAACCATCAGCAATTGAAGTAAACGCCCGCCGGCTTCC
CGGGATACGGTCTAACCACAAATATAATCCACGGTGGAATTGAATGTGGC
CAAGGTGGGAATGACCCTGTACCCACCCCTATTGGGTTCCTTACCCCTTT
TCGGTGGCAAGTTGGGGATTCGGCCCGGTGACCACCCTGATTGCCACACC
CACGGCCCTAAGGGCCTAACCGAAGGGCCCATTCCTAGTGATCCCCCTGA
TCCAGGTTTTAATAAATAAACCCTAATAAAAACCCACCTAAAAAAAACTT
TTAAATGGCCCAGTTGGTAGGGGGGCAACTAAATTTTTTCCTTTGGTTCC
CCCCTTATTGCAAGTAAAATAAA
back to top