DY259745

Overview
NameDY259745
Unique NameDY259745
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1023
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIT_DIOJA (Acidic endochitinase OS=Dioscorea japonica PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 1.026e-22
Identity = 74/250 (29.60%), Postives = 110/250 (44.00%), Query Frame = 1
Query:   82 CGSGVVCGER-DTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCY--RYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGFLTPFRWQVGDS 822
            CG G   G   D   G     +  I+++E F D +  +    CP + FYT   F+EA  A+P FG    +  RKREIAA+FA    ET                CYI +    A++YC   +  PC    +Y+GRGP+QL+WN NY+  G+ L                 SFK+++WFW+       +  + +  + N            G+G T  II+GG EC       +   +G+   +  Q+G S
Sbjct:   25 CGPGCQAGPCWDPCEGDGTLTVSDIVTQE-FWDGIASQAAANCPGKSFYTRSNFLEAVSAYPGFGTKCTDEDRKREIAAYFAHVTHET-------------GHLCYIEERDGHANNYCQESQQYPCNPNKEYFGRGPMQLSWNYNYIDAGKELHFDGLNDPDIVGRDPIISFKTSLWFWI------RKGVQYVILDPNQ-----------GFGATIRIINGGQECDGHNTAQMMARVGYYQEYCAQLGVS 243          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIA_MAIZE (Endochitinase A OS=Zea mays PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.750e-22
Identity = 70/231 (30.30%), Postives = 101/231 (43.72%), Query Frame = 1
Query:   85 GSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC---YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDP 768
            G G   G    G G+ G  +  +++   F  +        C  + FYT  AF+ A  A+P F + G E   KREIAAFFA    ET               +CYI ++++ ++ YC    R  PC    +YYGRGP+Q++WN NY   G  +G                +FK+A+WFWM             + +G   Q         G+G T   I+G +EC   GN+P
Sbjct:   61 GGGGGGGGGGGGGGSGGANVANVVTDAFFNGIKNQAGS-GCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGH-------------FCYISEINK-SNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQDAVIAFKTALWFWMN------------NVHGVMPQ---------GFGATIRAINGALEC--NGNNP 253          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI4_PHAVU (Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 5.630e-21
Identity = 72/249 (28.92%), Postives = 100/249 (40.16%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC----YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGFLTPFRWQVG 816
            CG+G   G   T        +   I    F + +  + D  C  + FYT DAF+ A  ++  FG  G+E   KREIAA FA    ET               +CYI ++   + DYC        PC     Y+GRGPIQL+WN NY   G A                  SFK+A+W+WM                   Q ++  P    G+G T   I+G +EC       V   + + T +  Q+G
Sbjct:   47 CGTGCQQGPCTTASPPPSNNVNADILTADFLNGIIDQADSGCAGKNFYTRDAFLSALNSYTDFGRVGSEDDSKREIAAAFAHFTHET-------------GHFCYIEEIDGASKDYCDEESIAQYPCSSSKGYHGRGPIQLSWNFNYGPAGSANNFDGLGAPETVSNDVVVSFKTALWYWM-------------------QHVR--PVINQGFGATIRAINGALECDGANPTTVQARVNYYTEYCRQLG 261          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI4_ORYSJ (Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht4 PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 9.603e-21
Identity = 70/255 (27.45%), Postives = 100/255 (39.22%), Query Frame = 1
Query:   67 GSAQNCGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC---YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGFLTPFRWQVGDS 822
            G     G     G      G   G   + +  E F + +  +    C  + FYT  +F+ AA+++  F N       KREIAAFFA    ET                CYI +++    DYC    +  PC    +YYGRGP+Q++WN NY   G+ +G                SFK+A+WFWM               N  HQ +        G+G T   I+G +EC       V   + +   +  Q G S
Sbjct:   58 GPCWGSGGEAAAGMAGRKAGAGAGVSVESVVTEAFFNGIKNQAPNGCAGKSFYTRQSFLNAARSYSGFANDRTNDDSKREIAAFFAHVTHET-------------GHMCYINEINGANMDYCDKSNKQWPCQPGKKYYGRGPLQISWNFNYGPAGKNIGFDGLRDPDKVAQDPTISFKTALWFWM---------------NNVHQVMS------QGFGATIRAINGALECNGKNPGAVNARVNYYKDYCRQFGVS 278          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI5_ORYSJ (Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht5 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.139e-20
Identity = 72/257 (28.02%), Postives = 102/257 (39.69%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGGELG---------KIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC---YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGFLTPFRWQVG 816
            C SG   G    G G  GG  G         + +  E F + +  +    C  + FYT  +F+ AA ++  F         KREIAAFFA    ET                CYI +++  + DYC    +  PC    +YYGRGP+Q++WN NY   G+ +G                SFK+A+WFWM               N  HQ +        G+G T   I+G +EC       V   + +   +  Q G
Sbjct:   57 CRSGPCYGGGGGGGGGGGGGGGGGGGSGVSVESVVTEAFFNGIKNQAPNGCAGKNFYTRQSFLNAAHSYSGFARDRTNDDSKREIAAFFAHVTHET-------------GHMCYINEINGASMDYCDKNNKQWPCQPGKKYYGRGPLQISWNYNYGPAGQNIGFDGLRDPDRVAQDPTISFKTALWFWM---------------NNVHQVM------LQGFGATIRAINGALECNGKNPGAVNARVNYYKDYCRQFG 279          
The following BLAST results are available for this feature:
BLAST of DY259745 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHIT_DIOJA1.026e-2229.60Acidic endochitinase OS=Dioscorea japonica PE=1 SV... [more]
CHIA_MAIZE1.750e-2230.30Endochitinase A OS=Zea mays PE=1 SV=1[more]
CHI4_PHAVU5.630e-2128.92Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE... [more]
CHI4_ORYSJ9.603e-2127.45Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI5_ORYSJ2.139e-2028.02Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB02FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259745 ID=DY259745|Name=DY259745|organism=Citrus clementina|type=EST|length=1023bp
GCTTTCAAAATGAGGCTCATTGGGTCCTTACTAATTTTCTCTCTAGTTTT
ATCTTTTGTACTAGGAGGTTCAGCACAGAATTGTGGAAGCGGCGTTGTGT
GCGGTGAACGTGATACTGGCCACGGGACGGATGGCGGTGAACTGGGCAAG
ATCATCTCAAGGGAGATGTTTGAAGACTTGCTTCCGTATAGAAATGATGT
ACGATGCCCTGCCAGAGGCTTCTACACTTACGATGCTTTTATAGAGGCAG
CCAAAGCTTTTCCAGCCTTTGGTAACTCTGGAAATGAAACCATGCGTAAA
AGAGAAATTGCTGCCTTTTTTGCCCAAACTGGCGATGAAACTACTGGGGG
ATGGCCCGATGCACCTGGTGGAGAATATGCTTGGGGATATTGCTATATTA
GGCAAGTTAGCCGCCCTGCGTCCGACTACTGTTATCGTTACTGTCCATGT
CCTTTGCCAGGGCAATACTATGGCCGAGGTCCAATTCAACTCACTTGGAA
TTGCAATTACTTAAGGTGCGGAGAAGCCTTGGGGGTGGACTTGTTGAACA
ATCCAGACCTTCTTGCCCCTGATCCAGTACTATCATTCAAGTCAGCAATC
TGGTTCTGGATGACTGCACAGCCCCAAAGCCATCGTGCCACGAAGTCATT
ATCGACGAATGGAAACCATCAGCAATTGAAGTAAACGCCCGCCGGCTTCC
CGGGATACGGTCTAACCACAAATATAATCCACGGTGGAATTGAATGTGGC
CAAGGTGGGAATGACCCTGTACCCACCCCTATTGGGTTCCTTACCCCTTT
TCGGTGGCAAGTTGGGGATTCGGCCCGGTGACCACCCTGATTGCCACACC
CACGGCCCTAAGGGCCTAACCGAAGGGCCCATTCCTAGTGATCCCCCTGA
TCCAGGTTTTAATAAATAAACCCTAATAAAAACCCACCTAAAAAAAACTT
TTAAATGGCCCAGTTGGTAGGGGGGCAACTAAATTTTTTCCTTTGGTTCC
CCCCTTATTGCAAGTAAAATAAA
back to top