DY259871
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DNJB6_XENTR (DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 1.476e-12 Identity = 39/76 (51.32%), Postives = 49/76 (64.47%), Query Frame = 3 Query: 153 ELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSG 380 E Y +L + AS E+I+KAYR+ A +HPDK P K+ A F+ + EAYE+LSD KR IYD YG EGLT G Sbjct: 3 EYYDVLGVQRNASPEDIKKAYRKLALKWHPDKN--PDNKDEAERRFKEVAEAYEVLSDSKKRDIYDKYGKEGLTGG 76
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DNJB5_MOUSE (DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 1.476e-12 Identity = 36/77 (46.75%), Postives = 52/77 (67.53%), Query Frame = 3 Query: 150 RELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSG 380 ++ Y +L + A+++EI+KAYR+ A YHPDK + P+ A E F+ I EAY++LSD KR +YD YG EGL +G Sbjct: 3 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPN----AEEKFKEIAEAYDVLSDPKKRSLYDQYGEEGLKTG 75
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DNJB2_HUMAN (DnaJ homolog subfamily B member 2 OS=Homo sapiens GN=DNAJB2 PE=2 SV=3) HSP 1 Score: 74.3294 bits (181), Expect = 1.476e-12 Identity = 40/79 (50.63%), Postives = 53/79 (67.09%), Query Frame = 3 Query: 159 YALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLELGP 395 Y +L + AS ++I+KAYR+ A +HPDK P KE A + F+ + EAYE+LSD++KR IYD YG EGLT G GP Sbjct: 5 YEILDVPRSASADDIKKAYRRKALQWHPDKN--PDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGREGLT-GTGTGP 80
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DJB10_MOUSE (DnaJ homolog subfamily B member 10 OS=Mus musculus GN=Dnajb10 PE=2 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 1.476e-12 Identity = 40/79 (50.63%), Postives = 53/79 (67.09%), Query Frame = 3 Query: 159 YALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLELGP 395 Y +L + AS ++I+KAYR+ A +HPDK P KE A + F+ + EAYE+LSD++KR IYD YG EGLT G GP Sbjct: 5 YEILDVPRSASPDDIKKAYRKKALQWHPDKN--PDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGREGLT-GAGSGP 80
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DNJB5_HUMAN (DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 2.518e-12 Identity = 36/77 (46.75%), Postives = 52/77 (67.53%), Query Frame = 3 Query: 150 RELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSG 380 ++ Y +L + A+++EI+KAYR+ A YHPDK + P+ A E F+ I EAY++LSD KR +YD YG EGL +G Sbjct: 3 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPN----AEEKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTG 75
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DNJB5_BOVIN (DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 2.518e-12 Identity = 36/77 (46.75%), Postives = 52/77 (67.53%), Query Frame = 3 Query: 150 RELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSG 380 ++ Y +L + A+++EI+KAYR+ A YHPDK + P+ A E F+ I EAY++LSD KR +YD YG EGL +G Sbjct: 3 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPN----AEEKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTG 75
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DNJB6_RAT (DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 3.289e-12 Identity = 38/76 (50.00%), Postives = 49/76 (64.47%), Query Frame = 3 Query: 153 ELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSG 380 + Y +L + AS E+I+KAYR+ A +HPDK P KE A F+++ EAYE+LSD KR IYD YG EGL G Sbjct: 3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKN--PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGG 76
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DNJB6_PONAB (DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 3.289e-12 Identity = 38/76 (50.00%), Postives = 49/76 (64.47%), Query Frame = 3 Query: 153 ELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSG 380 + Y +L + AS E+I+KAYR+ A +HPDK P KE A F+++ EAYE+LSD KR IYD YG EGL G Sbjct: 3 DYYEVLGVQRHASPEDIKKAYRKLALKWHPDKN--PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGG 76
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DNJB6_MOUSE (DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4) HSP 1 Score: 73.1738 bits (178), Expect = 3.289e-12 Identity = 38/76 (50.00%), Postives = 49/76 (64.47%), Query Frame = 3 Query: 153 ELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSG 380 + Y +L + AS E+I+KAYR+ A +HPDK P KE A F+++ EAYE+LSD KR IYD YG EGL G Sbjct: 3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKN--PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGG 76
BLAST of DY259871 vs. ExPASy Swiss-Prot
Match: DNJB6_MACFA (DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 3.289e-12 Identity = 38/76 (50.00%), Postives = 49/76 (64.47%), Query Frame = 3 Query: 153 ELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSG 380 + Y +L + AS E+I+KAYR+ A +HPDK P KE A F+++ EAYE+LSD KR IYD YG EGL G Sbjct: 3 DYYEVLGVQRHASPEDIKKAYRKLALKWHPDKN--PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGG 76 The following BLAST results are available for this feature:
BLAST of DY259871 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 70
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DY259871 ID=DY259871; Name=DY259871; organism=Citrus clementina; type=EST; length=1150bpback to top |