DY260354
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY260354 vs. ExPASy Swiss-Prot
Match: EF118_ARATH (Ethylene-responsive transcription factor ERF118 OS=Arabidopsis thaliana GN=ERF118 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 2.296e-11 Identity = 30/39 (76.92%), Postives = 33/39 (84.62%), Query Frame = 2 Query: 353 GIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYD 469 G+RQR WGKWAAEIRDP K R WLGTF+T EEAA+AYD Sbjct: 115 GVRQRKWGKWAAEIRDPIKKTRTWLGTFDTLEEAAKAYD 153
BLAST of DY260354 vs. ExPASy Swiss-Prot
Match: DRE1G_ORYSJ (Dehydration-responsive element-binding protein 1G OS=Oryza sativa subsp. japonica GN=DREB1G PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.916e-11 Identity = 33/76 (43.42%), Postives = 47/76 (61.84%), Query Frame = 2 Query: 320 KPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDKEARKIRGKKAKVNFPNEEDVFTVTP 547 K K R +++G+R+R G+W E+R+P R+WLGTF TAE AARA+D A +RG+ A +NF + V P Sbjct: 46 KFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALRGRAACLNFADSPRRLRVPP 121
BLAST of DY260354 vs. ExPASy Swiss-Prot
Match: DRE1G_ORYSI (Dehydration-responsive element-binding protein 1G OS=Oryza sativa subsp. indica GN=DREB1G PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.916e-11 Identity = 33/76 (43.42%), Postives = 47/76 (61.84%), Query Frame = 2 Query: 320 KPKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDKEARKIRGKKAKVNFPNEEDVFTVTP 547 K K R +++G+R+R G+W E+R+P R+WLGTF TAE AARA+D A +RG+ A +NF + V P Sbjct: 46 KFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALRGRAACLNFADSPRRLRVPP 121
BLAST of DY260354 vs. ExPASy Swiss-Prot
Match: ERF26_ARATH (Ethylene-responsive transcription factor ERF026 OS=Arabidopsis thaliana GN=ERF026 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 5.114e-11 Identity = 33/65 (50.77%), Postives = 45/65 (69.23%), Query Frame = 2 Query: 326 KRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDKEARKIRGKKAKVNFPN 520 +R++ +YRGIR R GKW +EIR+P+K RVWLGT+ T E AA AYD A ++G +NFP+ Sbjct: 83 RRKKNPVYRGIRCRS-GKWVSEIREPKKTTRVWLGTYPTPEMAAAAYDVAALALKGGDTLLNFPD 146 The following BLAST results are available for this feature:
BLAST of DY260354 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 134
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DY260354 ID=DY260354; Name=DY260354; organism=Citrus clementina; type=EST; length=997bpback to top |