EH406238
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EH406238 vs. ExPASy Swiss-Prot
Match: TOM7A_ARATH (Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana GN=TOM7-1 PE=1 SV=1) HSP 1 Score: 102.449 bits (254), Expect = 1.345e-21 Identity = 47/75 (62.67%), Postives = 60/75 (80.00%), Query Frame = 2 Query: 92 MGSRVTLRT---KGKGVKGAKASEEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 307 M S ++L+ KGKG KGA +S++KS D KEW+ W++KKAKVVTHYGFIPL+I +GMNSDPKP ++QLLSPV Sbjct: 1 MESTISLKVNKGKGKGSKGASSSDDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPKPHLFQLLSPV 75
BLAST of EH406238 vs. ExPASy Swiss-Prot
Match: TOM7A_SOLTU (Mitochondrial import receptor subunit TOM7-1 OS=Solanum tuberosum GN=TOM7-1 PE=3 SV=3) HSP 1 Score: 89.3521 bits (220), Expect = 1.178e-17 Identity = 45/71 (63.38%), Postives = 54/71 (76.06%), Query Frame = 2 Query: 110 LRTKGKGVKGAKASEEK----SMVDSF-KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 307 L+ KGK K A A++E ++V F KEW TWT KKAKV+THYGFIPL+IIIGMNS+PKP + QLLSPV Sbjct: 2 LKPKGKNTKKAAAADEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72
BLAST of EH406238 vs. ExPASy Swiss-Prot
Match: TOM7B_ARATH (Mitochondrial import receptor subunit TOM7-2 OS=Arabidopsis thaliana GN=TOM7-2 PE=3 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 2.010e-17 Identity = 42/77 (54.55%), Postives = 54/77 (70.13%), Query Frame = 2 Query: 92 MGSRVTLRTKGK-----GVKGAKASEEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 307 M ++ TL+ KGK G + +S S FK+W+ W+++KAKV THYGFIPLIIIIGMNSDPKP ++ LLSPV Sbjct: 1 MAAKSTLKIKGKAKPSKGSSSSSSSSASSKYKVFKDWTNWSLQKAKVATHYGFIPLIIIIGMNSDPKPHLFHLLSPV 77 The following BLAST results are available for this feature:
BLAST of EH406238 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EH406238 ID=EH406238; Name=EH406238; organism=Citrus clementina; type=EST; length=530bpback to top |