EH406248

Overview
NameEH406248
Unique NameEH406248
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length584
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EH406248 vs. ExPASy Swiss-Prot
Match: NPL41_ARATH (NPL4-like protein 1 OS=Arabidopsis thaliana GN=At3g63000 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.225e-17
Identity = 45/75 (60.00%), Postives = 54/75 (72.00%), Query Frame = 1
Query:   16 IENRTTQVTMRALKSHLNRSPSLPLVKRISDXXXXXXXXXXXXXNSDVPALAQCVQAQTAVPEGYKLLINSMAET 240
            IENR TQ TMRALK+H+ R+ SLP VKRISD             +SDVPALA+CV+ Q+ VPEGY+LLI+SMA T
Sbjct:  338 IENRNTQTTMRALKTHMERARSLPFVKRISDFHLLLFVAQFLDVSSDVPALAECVRLQSHVPEGYELLIDSMANT 412          
BLAST of EH406248 vs. ExPASy Swiss-Prot
Match: NPL42_ARATH (NPL4-like protein 2 OS=Arabidopsis thaliana GN=At2g47970 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.090e-16
Identity = 43/75 (57.33%), Postives = 55/75 (73.33%), Query Frame = 1
Query:   16 IENRTTQVTMRALKSHLNRSPSLPLVKRISDXXXXXXXXXXXXXNSDVPALAQCVQAQTAVPEGYKLLINSMAET 240
            IENR+++ TMRALK+HL+R+ SLPLVK++SD             +SDVPALA+CV+ Q+ VPEGY LLI SMA T
Sbjct:  338 IENRSSRATMRALKTHLDRAKSLPLVKKMSDFHLLLFVAQFLDVSSDVPALAECVRLQSPVPEGYALLIESMANT 412          
BLAST of EH406248 vs. ExPASy Swiss-Prot
Match: NPL4_ORYSJ (NPL4-like protein OS=Oryza sativa subsp. japonica GN=Os01g0377700 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.294e-13
Identity = 39/73 (53.42%), Postives = 46/73 (63.01%), Query Frame = 1
Query:   16 IENRTTQVTMRALKSHLNRSPSLPLVKRISDXXXXXXXXXXXXXNSDVPALAQCVQAQTAVPEGYKLLINSMA 234
            IENR   V M ALKSHL+R+  LP VKRISD              +DVPAL  CV+ Q+ VPEGY+LLI S+A
Sbjct:  341 IENRGNPVAMSALKSHLDRAKHLPFVKRISDFHLLLLVAAFLDIKADVPALTACVKNQSVVPEGYQLLIESLA 413          
The following BLAST results are available for this feature:
BLAST of EH406248 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
NPL41_ARATH3.225e-1760.00NPL4-like protein 1 OS=Arabidopsis thaliana GN=At3... [more]
NPL42_ARATH2.090e-1657.33NPL4-like protein 2 OS=Arabidopsis thaliana GN=At2... [more]
NPL4_ORYSJ6.294e-1353.42NPL4-like protein OS=Oryza sativa subsp. japonica ... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAB2BC04ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH406248 ID=EH406248; Name=EH406248; organism=Citrus clementina; type=EST; length=584bp
GGGACAGTCGGGGGCATTGAGAACAGAACCACTCAAGTTACCATGAGAGC
ACTGAAGAGTCATCTGAACCGAAGCCCAAGTCTTCCACTAGTGAAGCGAA
TTTCTGATTTTCACTTGCTGCTCTTTCTGGCAAGGTTTCTTGATCTCAAT
TCTGATGTCCCTGCATTGGCACAGTGTGTGCAGGCACAGACAGCAGTACC
AGAAGGCTACAAGCTTCTAATTAACTCAATGGCTGAGACAGTATAATTTA
AGATTGCAATTTGGGCTTGTTCAGTGGTACACGCCTGGGCATGAGGATCA
ATCTTTATTGCTTTTTAACCCATGCTTTGTCCAAGAGAGGGGCTTTGAGC
CTCGTAAGTCATAAAATGGCTCTGTGCACGAGCTCTTATGACCTTTTACC
TTATCAATTGGTCTGATGTTCATGCTTTGCAGGAACAAGGCTGTGTTTAT
AGTTAAAACTGCTTTATTTGTTATGTCATCTAAACAGTTGGCCTTGTGAA
TTATCATGGGAACCATAGTTTGGTAAAATTGCATTGTTTCATGCTCTTAA
CTACCTGACCTGAATCCTGGTTTCACTGGTATTA
back to top