FC868541

Overview
NameFC868541
Unique NameFC868541
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length642
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 4.279e-69
Identity = 116/153 (75.82%), Postives = 131/153 (85.62%), Query Frame = 2
Query:  155 QKSRSVAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADII 613
            QK+ S+ GATKASF            A  G+RSV+VSA AADP+RPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPE+L+WN Q+E+VH RWAMLGAAGIFIPE LTK+G+LNTPSWYTAGE EYFTDTTTLF++E++ IGWAEGRRWADII
Sbjct:   21 QKNGSIVGATKASFLGGKRLRVSKFIAPVGSRSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWADII 173          

HSP 2 Score: 27.335 bits (59), Expect = 4.279e-69
Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 1
Query:  613 KPGCVNTDPI 642
            KPGCVNTDPI
Sbjct:  174 KPGCVNTDPI 183          
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.605e-65
Identity = 112/153 (73.20%), Postives = 124/153 (81.05%), Query Frame = 2
Query:  155 QKSRSVAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADII 613
            +++ S+ G TKASF             T   RS +    AADP+RPLWFPGSTPP WLDGSLPGDFGFDPLGL SDPE+LRWN Q+E+VHCRWAMLGAAGIFIPELLTK+GILNTPSWYTAGE EYFTDTTTLFIVE++ IGWAEGRRWADII
Sbjct:   21 RRNGSIVGTTKASFLGGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADII 173          

HSP 2 Score: 27.335 bits (59), Expect = 1.605e-65
Identity = 10/10 (100.00%), Postives = 10/10 (100.00%), Query Frame = 1
Query:  613 KPGCVNTDPI 642
            KPGCVNTDPI
Sbjct:  174 KPGCVNTDPI 183          
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 8.666e-33
Identity = 61/105 (58.10%), Postives = 76/105 (72.38%), Query Frame = 2
Query:  296 WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADI 610
            W PG   P +L GSLPGD GFDPLGL  DPE LRW VQ+E+V+ RWAMLG AG+ +PE+ T +GI+N P WY AG+ EYF  ++TLF++E I   + E RRW DI
Sbjct:   56 WLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDI 160          
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 8.666e-33
Identity = 61/120 (50.83%), Postives = 82/120 (68.33%), Query Frame = 2
Query:  251 SVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADI 610
            S   S+   +  +  W PG   P++L GSL GD GFDPLGL  DPE L+W VQ+E+V+ RWAMLG AG+ +PE+ TK+GI+N P WY AG+ +YF  ++TLF++E I   + E RRW DI
Sbjct:   42 SAKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDI 161          
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 6.651e-25
Identity = 60/122 (49.18%), Postives = 75/122 (61.48%), Query Frame = 2
Query:  248 RSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWY-TAGELEYFTDTTTLFIVEMIFIGWAEGRRWADI 610
            R V+V A  +      W PG   P +LDGSL GD GFDPL L  DPE LRW VQ+++V+ RWAMLG AG+ IPE+LTK G++N P W    G+  YF  ++T   V M    + E RRW DI
Sbjct:   26 RDVAVQAKGS------WLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSST-YVEIRRWQDI 140          
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.174e-21
Identity = 59/156 (37.82%), Postives = 82/156 (52.56%), Query Frame = 2
Query:  170 VAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPGST------PPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTA----GELEYFTDTTTLFIVEMIFIGWAEGRRWAD 607
            ++G  K+S              +  +R + V AAAA P +  W P          PEWLDGSLPGDFGFDPLGLG DP  L+W  ++E++H RWAML   GIF+ +  T +       W+ A    G +  F+   TL   +++ +GW E +RW D
Sbjct:   19 LSGGKKSSQSLLFVNSKVGAGVSTTSRKLVVVAAAAAPKKS-WIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMLAVLGIFVGQAWTGI------PWFEAGADPGAVAPFS-FGTLLGTQLLLMGWVESKRWVD 166          
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.416e-21
Identity = 61/142 (42.96%), Postives = 80/142 (56.34%), Query Frame = 2
Query:  245 TRSVSVSAAAADP------NRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETL------RWNVQSEIVHCRWAMLGAAGIFIPELLTKLGIL---NTPSWY------TAGELEYFTDTTTLFIVEMIFIGWAEGRRWAD 607
            +R   V AAA  P      +RPLWF       +LDGSLPGD+GFDPLGL SDPE        RW    E+++ R+AMLGA G   PE L K+G++      +W+       AG   Y+ D  TLF++EM  +G+AE RR+ D
Sbjct:   35 SRKGLVRAAATPPVKQGGVDRPLWFASKQSLSYLDGSLPGDYGFDPLGL-SDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQD 175          
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 9.938e-21
Identity = 57/135 (42.22%), Postives = 75/135 (55.56%), Query Frame = 2
Query:  248 RSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETL------RWNVQSEIVHCRWAMLGAAGIFIPELLTKLGIL---NTPSWY------TAGELEYFTDTTTLFIVEMIFIGWAEGRRWAD 607
            R+ S        NR LWF       +LDG LPGDFGFDPLGL SDPE        +W    E+++ R+AMLGAAG   PE+L K G++      +W+       AG   Y+ D  TLF++EM  +G+AE RR+ D
Sbjct:   40 RAASTPPVKQGANRQLWFASKQSLSYLDGRLPGDFGFDPLGL-SDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQD 173          
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.435e-19
Identity = 51/126 (40.48%), Postives = 71/126 (56.35%), Query Frame = 2
Query:  260 VSAAAADPNRPLWFPGS------TPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTA----GELEYFTDTTTLFIVEMIFIGWAEGRRWAD 607
            V+AAA  P +  W P          PEWLDGSLPGDFGFDPLGLG DP  L+W  ++E++H RWAM    GIF+ +  + +       W+ A    G +  F+   +L   +++ +GW E +RW D
Sbjct:   44 VAAAAVAPKKS-WIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGI------PWFEAGADPGAIAPFS-FGSLLGTQLLLMGWVESKRWVD 161          
BLAST of FC868541 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.197e-19
Identity = 53/133 (39.85%), Postives = 73/133 (54.89%), Query Frame = 2
Query:  239 AGTRSVSVSAAAADPNRPLWFPGS------TPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTA----GELEYFTDTTTLFIVEMIFIGWAEGRRWAD 607
            A  +  +V AAAA  +   W P          PEWLDGSLPGD+GFDPLGLG DP  L+W  ++E++H RWAM    GIF+ +  + +       W+ A    G +  F+   TL   ++I +GW E +RW D
Sbjct:   39 ATPKRFTVLAAAAKKS---WIPAVRGGGNLVDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGI------PWFEAGADPGAIAPFS-FGTLLGTQLILMGWVESKRWVD 161          
The following BLAST results are available for this feature:
BLAST of FC868541 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
CB12_PETHY4.279e-6975.82Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC1.605e-6573.20Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB24_PEA8.666e-3358.10Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB24_ARATH8.666e-3350.83Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB120_HORVU6.651e-2549.18Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB4_SPIOL1.174e-2137.82Chlorophyll a-b binding protein CP24, chloroplasti... [more]
CB23_PEA3.416e-2142.96Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB13_SOLLC9.938e-2142.22Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB4B_SOLLC1.435e-1940.48Chlorophyll a-b binding protein CP24 10B, chloropl... [more]
CB4A_SOLLC3.197e-1939.85Chlorophyll a-b binding protein CP24 10A, chloropl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001F11EF AbioticL1 Citrus clementina cDNA clone C31001F11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868541 ID=FC868541; Name=FC868541; organism=Citrus clementina; type=EST; length=642bp
GAAGTTTTTGTATCTTCTGTTCTCCGCCAATTGTATTCTACTTTACACGC
ACACAAACGCCAGTCATAATTTTGCTGAAAGCCTTTGCCTGGTAGTAAAA
ATGGCTTCCGTTTGTGCTTCCCCTGCCGTTGCAGCCATCTCATCCCCCAG
TTCTCAGAAGAGTAGATCAGTTGCGGGAGCAACAAAGGCTTCTTTCCTTG
GTGGGAAGAAGCTGAAATTGAGAAAAAACGGAGCAACAGCGGGAACACGA
TCGGTTTCAGTGAGTGCGGCTGCAGCTGATCCTAACAGGCCTCTCTGGTT
CCCAGGCAGCACTCCTCCTGAATGGCTCGATGGTAGCCTCCCCGGAGACT
TCGGCTTCGATCCTCTTGGTCTTGGATCTGATCCTGAGACGCTGAGATGG
AACGTGCAATCAGAAATTGTGCACTGCAGATGGGCAATGTTAGGAGCTGC
AGGAATTTTCATTCCGGAATTGTTAACAAAACTTGGAATCCTCAACACTC
CATCCTGGTACACAGCTGGGGAGCTAGAGTACTTCACAGACACCACCACC
CTGTTCATTGTTGAGATGATATTCATAGGCTGGGCAGAGGGCAGACGGTG
GGCCGACATTATAAGCCAGGCTGTGTGAACACTGACCCGATC
back to top