FC868544

Overview
NameFC868544
Unique NameFC868544
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 357.066 bits (915), Expect = 4.981e-98
Identity = 172/204 (84.31%), Postives = 179/204 (87.75%), Query Frame = 2
Query:   62 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MATSAIQQSAFAGQTAL+QSNE V K+G   GGR++MRRTVKS P SIWYGPDRPKYLGPFS+Q PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDPD
Sbjct:    1 MATSAIQQSAFAGQTALKQSNELVCKIGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPD 204          
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 1.039e-95
Identity = 170/204 (83.33%), Postives = 176/204 (86.27%), Query Frame = 2
Query:   62 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MATSAIQQSAFAGQTAL+  NE VRK+G   GGR TMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDP+
Sbjct:    1 MATSAIQQSAFAGQTALKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPE 204          
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 3.022e-95
Identity = 167/204 (81.86%), Postives = 177/204 (86.76%), Query Frame = 2
Query:   62 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MATSAI+QSAFAGQTAL+  NE VRK+G  +GGR TMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WA QVVLMG +EGYR+                AFDPLGLADDP+
Sbjct:    1 MATSAIEQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPE 204          
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.500e-94
Identity = 167/204 (81.86%), Postives = 174/204 (85.29%), Query Frame = 2
Query:   62 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MAT AIQQSAF GQ   +  NEF+RKVG    GRITMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDP+
Sbjct:    1 MATCAIQQSAFVGQAVGKSQNEFIRKVGNFGEGRITMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPE 204          
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2)

HSP 1 Score: 343.584 bits (880), Expect = 5.699e-94
Identity = 164/204 (80.39%), Postives = 177/204 (86.76%), Query Frame = 2
Query:   62 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MATS IQQSAFAGQT L+  NE VRKVG  +GGR++MRRT+KS P+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+L+KNGVKFGEAVWFKAG+QIF EGGLDYLGNPNL+HAQSILAIWACQVVLMG VEGYR+                AFDPLGLA+DP+
Sbjct:    1 MATSTIQQSAFAGQTLLKPQNELVRKVG-GNGGRVSMRRTIKSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSILAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPLGLAEDPE 203          
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.658e-93
Identity = 165/204 (80.88%), Postives = 173/204 (84.80%), Query Frame = 2
Query:   62 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MATSAIQQSAF G+T LRQ NEF+RK G     R TMRRTVKS P+SIWYGPDRPKYLGPFSEQ PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPE+L KNGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD
Sbjct:    1 MATSAIQQSAFTGKTGLRQGNEFIRKRGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGPFSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPD 204          
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB21_LEMGI (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Lemna gibba PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 2.828e-93
Identity = 165/204 (80.88%), Postives = 178/204 (87.25%), Query Frame = 2
Query:   62 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MA SAIQ SAFAGQTAL+Q +E VRKVGV+DG R +MRRTVK+ PQSIWYG DRPK+LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPE+LSKNGV+FGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYR+                AFDPLGLADDP+
Sbjct:    1 MAASAIQSSAFAGQTALKQRDELVRKVGVSDG-RFSMRRTVKAVPQSIWYGADRPKFLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSKNGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPE 203          
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 1.112e-89
Identity = 165/204 (80.88%), Postives = 174/204 (85.29%), Query Frame = 2
Query:   62 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MA SA+ Q+     TA R+ +E VR+VG + GGRITMRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD
Sbjct:    1 MAASALHQTTSFLGTAPRR-DELVRRVGDS-GGRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPD 202          
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 1.112e-89
Identity = 165/204 (80.88%), Postives = 174/204 (85.29%), Query Frame = 2
Query:   62 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MA SA+ Q+     TA R+ +E VR+VG + GGRITMRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD
Sbjct:    1 MAASALHQTTSFLGTAPRR-DELVRRVGDS-GGRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPD 202          
BLAST of FC868544 vs. ExPASy Swiss-Prot
Match: CB21_PINTH (Chlorophyll a-b binding protein type I, chloroplastic OS=Pinus thunbergii PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 9.416e-89
Identity = 162/206 (78.64%), Postives = 173/206 (83.98%), Query Frame = 2
Query:   62 MAT-SAIQQSAFAGQTALR-QSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPD 673
            MAT SAIQ S+ AGQT LR Q NE V+KVG A   RITMRRTV+S P+SIWYGPDRPKYLGPFSE TPSYLTGEFPGDYGWDTA +SADPETFAKNRELEVIH RWAMLGALGCVFPE+L+KNG+KFGEAVWFKAGAQIFSEGGLDY GNPNLIHAQSILAIWACQVVLMG +EGYR+                AFDPLGLADDP+
Sbjct:    1 MATASAIQSSSLAGQTLLRPQQNELVKKVGTAQA-RITMRRTVRSAPESIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLKFGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGTLGEGLDPLLPGGAFDPLGLADDPE 205          
The following BLAST results are available for this feature:
BLAST of FC868544 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 71
Match NameE-valueIdentityDescription
CB21_GOSHI4.981e-9884.31Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB26_PETSP1.039e-9583.33Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB23_TOBAC3.022e-9581.86Chlorophyll a-b binding protein 36, chloroplastic ... [more]
CB24_SOLLC1.500e-9481.86Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB21_SILPR5.699e-9480.39Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB215_PEA1.658e-9380.88Chlorophyll a-b binding protein 215, chloroplastic... [more]
CB21_LEMGI2.828e-9380.88Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB23_ORYSJ1.112e-8980.88Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI1.112e-8980.88Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_PINTH9.416e-8978.64Chlorophyll a-b binding protein type I, chloroplas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001G03EF AbioticL1 Citrus clementina cDNA clone C31001G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868544 ID=FC868544; Name=FC868544; organism=Citrus clementina; type=EST; length=676bp
GATATTCAGAGTGCGAAAAGAAGCCTCAGCAACAAAAGGAAAAGCTTTCG
CATAAGAACATATGGCAACCTCTGCTATCCAACAATCAGCATTTGCTGGC
CAGACCGCCTTGAGGCAATCCAATGAGTTTGTCCGCAAGGTTGGAGTTGC
TGACGGTGGCCGTATCACCATGAGGAGGACTGTCAAATCCACTCCCCAGA
GCATCTGGTACGGCCCAGACCGCCCAAAGTACTTGGGACCATTCTCTGAG
CAAACACCATCATACTTGACTGGTGAGTTCCCTGGTGACTATGGCTGGGA
TACCGCTGGTTTATCAGCAGACCCCGAGACATTTGCTAAGAACCGTGAGC
TAGAGGTGATCCACAGCAGATGGGCAATGCTTGGAGCTCTTGGCTGCGTC
TTCCCTGAAATCCTCTCCAAGAATGGAGTGAAGTTCGGCGAAGCAGTTTG
GTTCAAGGCTGGCGCTCAAATCTTCTCTGAAGGTGGCCTTGACTATCTTG
GCAACCCCAACCTCATTCATGCTCAGAGCATTTTGGCTATCTGGGCCTGC
CAGGTTGTGCTCATGGGTTTTGTTGAAGGATACAGAATTGGTGGCGGTCC
TCTTGGTGAAGGACTTGACCCACTTTTACCTGGTGGTGCTTTTGACCCAC
TTGGTTTGGCTGATGACCCCGATCAA
back to top