FC868554

Overview
NameFC868554
Unique NameFC868554
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length666
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9492 contig Ccv1_Contig9492:111..776. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER42_ARATH (Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=1 SV=2)

HSP 1 Score: 390.193 bits (1001), Expect = 5.120e-108
Identity = 181/215 (84.19%), Postives = 201/215 (93.49%), Query Frame = 2
Query:   20 ASNEEDPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPD 664
            A  E +PGL+MNFYKDTCPQAEDI++EQVKLLYKRHKNTAFSWLRNIFHDCAV+SCDASLLLDSTR+ L EKE DRSFG+RNFRYIE IKEA+ERECPGVVSC+DILVLS R+G+ A+GGPYIPLKTGRRDG KSR ++LE YLPDHN+S+SVVLE+F +IGID PGLVALLGSHSVGRTHCVKLVHRLYPEVDP+LNPDHVPHMLHKCPD+IPD
Sbjct:   23 AVTEAEPGLMMNFYKDTCPQAEDIVREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRELGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPYIPLKTGRRDGLKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHRLYPEVDPSLNPDHVPHMLHKCPDSIPD 237          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER21_ARATH (Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=1 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.363e-68
Identity = 121/208 (58.17%), Postives = 158/208 (75.96%), Query Frame = 2
Query:   44 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIP-LKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPD 664
            L MN+YK++CP+AE+II++QV+ LY +H NTA SWLRN+FHDC V+SCDASLLL++ R   SE++  RSFGMRNF+Y++ IK+A+E+ECP  VSCADI+ LS RDG+V L GP I  +KTGRRD R S    +E  +P+HNDS+S V+  F +IGID    VALLG+HSVGR HCV LVHRLYP +DP L+P +  ++  +CP   PD
Sbjct:   30 LEMNYYKESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLETARGVESEQKSKRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIEMIKTGRRDSRGSYLGDVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCVNLVHRLYPTIDPTLDPSYALYLKKRCPSPTPD 237          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER48_ARATH (Putative Peroxidase 48 OS=Arabidopsis thaliana GN=PER48 PE=2 SV=3)

HSP 1 Score: 167.162 bits (422), Expect = 7.049e-41
Identity = 82/220 (37.27%), Postives = 134/220 (60.91%), Query Frame = 2
Query:   14 ALASNEEDPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKCPDAI 658
            ++A + +   L  ++Y+++CP AE II + ++ +Y    + A   +R +FHDC ++ CDAS+LLD+     SEK+   +  ++ F  I+ +K  +E  CPGVVSCAD+LVL+ R+ V+  GGP+ PL+TGR+D   +  +  E  LP  + ++SV+L+RF+  G +    V+L G+HS+G THC    +RLY      + DP LNP  +  +  KCP ++
Sbjct:   58 SIAEDIDRSYLHYDYYRESCPTAEKIIAKAIRDIYNVTPSVAPPIIRLLFHDCFIEGCDASVLLDADEAHTSEKDASPNLSLKGFDVIDAVKSELENVCPGVVSCADLLVLAAREAVLVAGGPFYPLETGRKDSAAAYRDFAEHELPAPDATLSVILQRFSFRGFNERETVSLFGAHSIGITHCTFFKNRLYNFSATGKPDPELNPGFLQELKTKCPFSV 277          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER55_ARATH (Peroxidase 55 OS=Arabidopsis thaliana GN=PER55 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.347e-36
Identity = 83/219 (37.90%), Postives = 126/219 (57.53%), Query Frame = 2
Query:   29 EEDPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMD--RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRL-----YPEVDPALNPDHVPHMLHKCPDAIPD 664
            E +  L  N+Y  TCP  E I+K+ V   +K+   TA + LR  FHDC V+ CDAS+ + S  +  +EK+ D  +S     F  +   K AVE +CPGVVSCADIL L+ RD VV +GGP   ++ GRRDG  S+A  +   LP+    +  +++ FA+ G+    ++AL G+H++G +HC +  +RL     +  VDP ++P +   ++  C D  PD
Sbjct:   27 ESNAQLSENYYASTCPSVELIVKQAVTTKFKQTVTTAPATLRMFFHDCFVEGCDASVFIASENED-AEKDADDNKSLAGDGFDTVIKAKTAVESQCPGVVSCADILALAARDVVVLVGGPEFKVELGRRDGLVSKASRVTGKLPEPGLDVRGLVQIFASNGLSLTDMIALSGAHTIGSSHCNRFANRLHNFSTFMPVDPTMDPVYAQQLIQACSDPNPD 244          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER64_ARATH (Peroxidase 64 OS=Arabidopsis thaliana GN=PER64 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.521e-35
Identity = 82/204 (40.20%), Postives = 114/204 (55.88%), Query Frame = 2
Query:   53 NFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKCP 649
            ++Y  TCPQA+ I+   VK      +    + LR  FHDC V+ CD S+LLDS  K  +EK+   +  +  F  I+N K+A+E +CPG+VSCADIL L+ RD V   GGP   +  GR+DGR S+A I  + LP    ++S + + F   G+    LVAL G H++G  HC    +RL+      EVDP LNP     +   CP
Sbjct:   26 HYYDHTCPQADHIVTNAVKKAMSNDQTVPAALLRMHFHDCFVRGCDGSVLLDSKGKNKAEKDGPPNISLHAFYVIDNAKKALEEQCPGIVSCADILSLAARDAVALSGGPTWAVPKGRKDGRISKA-IETRQLPAPTFNISQLRQNFGQRGLSMHDLVALSGGHTLGFAHCSSFQNRLHKFNTQKEVDPTLNPSFAARLEGVCP 228          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER11_ARATH (Peroxidase 11 OS=Arabidopsis thaliana GN=PER11 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.595e-35
Identity = 70/198 (35.35%), Postives = 115/198 (58.08%), Query Frame = 2
Query:   32 EDPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFG-MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYP--EVDPALNP 616
            +D  L +++YK TCP   D+IK++++ + K     A   +R  FHDC VQ CD S+LLD T     EK+   +   ++ ++ ++ IK  +E ECPGVVSCAD+L +  RD  + +GGPY  +  GR+D + +  E+    LP   + +  ++ +F + G+    +VAL+G+H++G+  C     R+Y   +V  ALNP
Sbjct:   26 KDLPLTLDYYKSTCPTVFDVIKKEMECIVKEDPRNAAIIIRLHFHDCFVQGCDGSVLLDETETLQGEKKASPNINSLKGYKIVDRIKNIIESECPGVVSCADLLTIGARDATILVGGPYWDVPVGRKDSKTASYELATTNLPTPEEGLISIIAKFYSQGLSVEDMVALIGAHTIGKAQCRNFRSRIYGDFQVTSALNP 223          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER56_ARATH (Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.389e-35
Identity = 79/207 (38.16%), Postives = 119/207 (57.49%), Query Frame = 2
Query:   41 GLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKC 646
            GL + FY   CP+AE I+K+ V    K  +  A   LR  FHDC V+ C+ S+LL+   K   EK    +  +R F  I+N+K A+E+ECPG+VSC+D+L L  RD +VAL GP   ++TGRRDG  +        LP   +++S ++ +F + G+D   LV L G H++G  HC ++ +RLY      + DP L+ ++   +  KC
Sbjct:   31 GLKVGFYDKACPKAELIVKKSVFEAVKNDRTIAAPLLRMFFHDCFVRGCEGSVLLELKNKK-DEKNSIPNLTLRGFEIIDNVKAALEKECPGIVSCSDVLALVARDAMVALNGPSWEVETGRRDGLVTNITEALLNLPSPFNNISSLITQFQSKGLDKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPNLDTEYAVKLRGKC 236          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER17_ARATH (Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 5.780e-35
Identity = 74/204 (36.27%), Postives = 115/204 (56.37%), Query Frame = 2
Query:   56 FYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEK-EMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPE-----VDPALNPDHVPHMLHKCP 649
            FY +TCP+AE I++ ++K    +   +  S +R  FHDC V  CDASLLLD T   L EK  +     +R+F  +++IKEA+E+ CP  VSCADI++++ RD V   GGP   +K GR+D   +  +  +  +P    + + +++ F    +    +VAL GSHS+G+  C  ++ RLY +      DPAL P +   +   CP
Sbjct:   27 FYSETCPEAESIVRREMKKAMIKEARSVASVMRFQFHDCFVNGCDASLLLDDTPNMLGEKLSLSNIDSLRSFEVVDDIKEALEKACPATVSCADIVIMAARDAVALTGGPDWEVKLGRKDSLTASQQDSDDIMPSPRANATFLIDLFERFNLSVKDMVALSGSHSIGQGRCFSIMFRLYNQSGSGKPDPALEPSYRKKLDKLCP 230          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER52_ARATH (Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.682e-34
Identity = 79/205 (38.54%), Postives = 106/205 (51.71%), Query Frame = 2
Query:   44 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEM-DRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDA 655
            L  NFY  +CP     ++  VK           S LR  FHDC V  CD S+LLD T     E+         R F  I+NIK AVE+ CPGVVSCADIL ++ RD VVALGGP   +K GRRD R +        +P    S+S ++  F+A+G+    +VAL G+H++G++ C     R+Y E +  +N          CP A
Sbjct:   30 LTTNFYSTSCPNLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRARIYNETN--INAAFATTRQRTCPRA 232          
BLAST of FC868554 vs. ExPASy Swiss-Prot
Match: PER43_ARATH (Peroxidase 43 OS=Arabidopsis thaliana GN=PER43 PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 2.196e-34
Identity = 78/207 (37.68%), Postives = 116/207 (56.04%), Query Frame = 2
Query:   44 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYP-----EVDPALNPDHVPHMLHKCP 649
            L + FY +TCPQAE I+K  V        N     LR  FHDC V+ CD S+L+++    +SEK      G+R F  +E +K  +E  CPGVVSC+DI+ L+ RD +    GP   + TGRRDGR S   + +  +P+ +DS+ ++  +F   G++A  LV L  +H++G T C  +  RLY      + DP +NP  +P +  +CP
Sbjct:   26 LEVGFYSNTCPQAESIVKRVVSGAALSDPNLPAILLRLHFHDCFVEGCDGSILVNNG--AISEKNAFGHEGVRGFEIVEAVKAELEAACPGVVSCSDIVALAARDAISLANGPAYEVPTGRRDGRVSNMSLAKD-MPEVSDSIEILKAKFMQKGLNAKDLVLLSAAHTIGTTACFFMSKRLYDFLPGGQPDPTINPTFLPELTTQCP 229          
The following BLAST results are available for this feature:
BLAST of FC868554 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 108
Match NameE-valueIdentityDescription
PER42_ARATH5.120e-10884.19Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=... [more]
PER21_ARATH1.363e-6858.17Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=... [more]
PER48_ARATH7.049e-4137.27Putative Peroxidase 48 OS=Arabidopsis thaliana GN=... [more]
PER55_ARATH2.347e-3637.90Peroxidase 55 OS=Arabidopsis thaliana GN=PER55 PE=... [more]
PER64_ARATH1.521e-3540.20Peroxidase 64 OS=Arabidopsis thaliana GN=PER64 PE=... [more]
PER11_ARATH2.595e-3535.35Peroxidase 11 OS=Arabidopsis thaliana GN=PER11 PE=... [more]
PER56_ARATH3.389e-3538.16Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=... [more]
PER17_ARATH5.780e-3536.27Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=... [more]
PER52_ARATH1.682e-3438.54Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=... [more]
PER43_ARATH2.196e-3437.68Peroxidase 43 OS=Arabidopsis thaliana GN=PER43 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001H01EF AbioticL1 Citrus clementina cDNA clone C31001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868554 ID=FC868554|Name=FC868554|organism=Citrus clementina|type=EST|length=666bp
GTCTCTGAGGTCTGCTTTGGCATCAAATGAAGAGGACCCAGGTCTTGTTA
TGAATTTTTACAAGGATACATGCCCTCAGGCCGAGGACATTATCAAGGAA
CAAGTTAAGCTTCTGTACAAGCGCCACAAGAACACTGCATTTTCTTGGCT
TAGAAACATTTTCCATGACTGTGCTGTCCAGTCTTGTGATGCTTCACTGC
TTCTGGACTCGACAAGAAAGACCTTGTCTGAGAAGGAAATGGACAGGAGC
TTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAAGAAGCTGTTGA
AAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCTTGTCCTGTCCG
GTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTCCTCTCAAGACA
GGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTTGAGCAGTATCT
CCCAGATCACAATGACAGCATGTCTGTTGTTCTTGAGAGGTTTGCAGCCA
TTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGATCTCACAGTGTT
GGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTACCCAGAAGTTGA
CCCTGCACTGAACCCTGACCACGTTCCGCATATGCTCCATAAGTGTCCTG
ATGCAATCCCAGACCC
back to top