FC868555

Overview
NameFC868555
Unique NameFC868555
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length666
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: DHGY_CUCSA (Glycerate dehydrogenase OS=Cucumis sativus GN=HPR-A PE=2 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 5.858e-104
Identity = 184/211 (87.20%), Postives = 191/211 (90.52%), Query Frame = 3
Query:   33 MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYG 665
            MAKPV IEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICT+KKTILSVEDI+ALIGDKCDGVIGQLTEDWGE LF+ALSRAGGKAFSNMAVGYNNVDVNAANKYG+AVGNTPGV                 RRIVEADEFMRAG YDGWLPNLFVGNLLKGQT+GVIGAGRIGSAYARMMVEGFKMNLIY+DLYQ+TRLEKFVTAYG
Sbjct:    1 MAKPVQIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTEKKTILSVEDILALIGDKCDGVIGQLTEDWGEVLFSALSRAGGKAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGRYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYFDLYQSTRLEKFVTAYG 211          
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: GYAR_KORCO (Glyoxylate reductase OS=Korarchaeum cryptofilum (strain OPF8) GN=gyaR PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.690e-18
Identity = 53/144 (36.81%), Postives = 78/144 (54.17%), Query Frame = 3
Query:  219 CDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYD-GWLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEK 647
            CD ++  LT+     +F A  +   +  +  AVGY+N+DV  A K GI V NTPGV                 RR+VEAD ++R G +   W P + +G  + G+T+G++G GRIG+A AR   +GF M ++YYD  +    EK
Sbjct:   46 CDALVSLLTDPIDAEVFEAAPKL--RIVAQYAVGYDNIDVKEATKRGIYVTNTPGVLTETTADFAFALLMAAARRVVEADRYVREGKWKVAWHPMMMLGYDVYGRTLGIVGMGRIGAAVAR-RAKGFGMRILYYDSIRREDFEK 186          
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: GYAR_THELI (Glyoxylate reductase OS=Thermococcus litoralis GN=gyaR PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.764e-18
Identity = 52/126 (41.27%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  294 KAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYD----GWLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTA 659
            K  +  AVGY+N+D+  A K GI V NTPGV                 RRIVEAD F+R+G +     GW P +F+G  LKG+T+G++G GRIG A A+   +GF M +IYY   +    E+ + A
Sbjct:   69 KIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAK-RAKGFGMKIIYYSRTRKPEAEEEIGA 193          
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: GYAR_PYRFU (Glyoxylate reductase OS=Pyrococcus furiosus GN=gyaR PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.916e-18
Identity = 64/195 (32.82%), Postives = 103/195 (52.82%), Query Frame = 3
Query:   75 KYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYD----GWLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEK 647
            K +V  T+ +P    IN+L E++  VE+  +++ I   E ++  + D  D ++  L+E   + +F    R   +  +N AVGY+N+DV  A + GI V NTP V                 R +V+ D+F+R+G +      W P  F+G  L G+TIG++G GRIG A AR   +GF M ++YY   + ++ EK
Sbjct:    2 KPKVFITRAIP-ENGINML-EEEFEVEVWEEEREIPR-EKLLEKVKD-VDALVTMLSERIDQEVFENAPRL--RIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTNATADHAFALLLATARHVVKGDKFVRSGEWKRKGIAWHPKWFLGYELYGKTIGIVGFGRIGQAIAR-RAKGFNMRILYYSRTRKSQAEK 189          
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: GYAR_PYRAB (Glyoxylate reductase OS=Pyrococcus abyssi GN=gyaR PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 7.099e-17
Identity = 59/181 (32.60%), Postives = 92/181 (50.83%), Query Frame = 3
Query:  129 LIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYD----GWLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTA 659
            ++E++  VE+   ++ I   E ++  + D  D ++  L+E     +F    R   +  +N AVGY+N+DV  A K GI V NTPGV                 R +V+ D+F R+G +      W P  F+G  + G+TIG+IG GRIG A A+    GF M ++YY   +   +EK + A
Sbjct:   19 MLEKEFEVEVWEDEREIPR-EILLEKVKD-VDALVTMLSERIDREVFERAPRL--RIVANYAVGYDNIDVEEATKRGIYVTNTPGVLTDATADLAFALLLATARHLVKGDKFTRSGEWKKRGVAWHPKWFLGYDVYGKTIGIIGFGRIGQAIAK-RARGFDMRILYYSRTRKPEVEKELNA 194          
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: GYAR_THEON (Glyoxylate reductase OS=Thermococcus onnurineus (strain NA1) GN=gyaR PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 9.271e-17
Identity = 64/195 (32.82%), Postives = 101/195 (51.79%), Query Frame = 3
Query:   75 KYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYD----GWLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEK 647
            K +V+ T+ +P    I +L E    VE+   +  I S E ++  + D  D ++  L+E     +F A  R   K  +N AVGY+N+D+  A K G+ + NTP V                 RR++EAD+F+R+G +      W P +F+G  + G+TIG++G GRIG A AR   +GF M ++Y    +   +EK
Sbjct:    2 KPKVLITRKIP-ENGIKMLREH-FEVEVWEDEHEI-SREVLLEKVRD-VDALVTMLSERIDAEVFDAAPRL--KIVANYAVGYDNIDIEEATKMGVYITNTPDVLTNATADMAWVLLLATARRLIEADKFVRSGEWKKRGVAWHPLMFLGYDVYGRTIGIVGFGRIGQAIAR-RAKGFGMRILYNSRTRKPEVEK 189          
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: GYAR_PYRKO (Glyoxylate reductase OS=Pyrococcus kodakaraensis GN=gyaR PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.211e-16
Identity = 58/177 (32.77%), Postives = 90/177 (50.85%), Query Frame = 3
Query:  129 LIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYD----GWLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEK 647
            ++++   VE+  +++ I   E ++  + D  D ++  L+E     +F A  R   +  +N AVGY+N+DV  A + GI V NTP V                 RR++EAD F R+G +      W P  F+G  + G+TIG++G GRIG A AR    GF M ++YY   +    EK
Sbjct:   18 MLKEHFEVEVWPEEREIPR-EVLLKKVRD-VDALVTMLSERIDSEVFDAAPRL--RIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTDATADFAWTLLLATARRLIEADHFTRSGEWKRRGIAWHPRWFLGYDVYGKTIGIVGFGRIGQAVAR-RARGFGMRILYYSRSRKPEAEK 189          
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: GYAR_THEPD (Glyoxylate reductase OS=Thermofilum pendens (strain Hrk 5) GN=gyaR PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.065e-16
Identity = 62/194 (31.96%), Postives = 96/194 (49.48%), Query Frame = 3
Query:   75 KYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYDG-WLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFV 653
            K  V    P PG      ++++ C V +   K    S E+++  I DK D ++  LT+     +  A      K  S  +VG++++D+  A K GI V +TPGV                 RRIVEAD+ +R G +D  W P    G  LKG+TIG++G GRIG A A+ +   F + ++YYD+ +   +E  +
Sbjct:    5 KVYVTRIIPEPGLS----MLKECCDVVVHESKDWPPSREELLRNIRDK-DALLCLLTDKIDAEVMDAAPNL--KVISTYSVGFDHIDIPEATKRGIYVTHTPGVLTDAVAEFTVGLILAVTRRIVEADKIIRTGQWDKPWNPYFLTGPELKGKTIGLVGLGRIGVATAKRL-SSFDVKILYYDIERRWDVETVI 190          
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: GYAR_PYRHO (Glyoxylate reductase OS=Pyrococcus horikoshii GN=gyaR PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 3.523e-16
Identity = 55/181 (30.39%), Postives = 91/181 (50.28%), Query Frame = 3
Query:  129 LIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYD----GWLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTA 659
            ++E +  VE+   +K I    +I+     + D ++  L+E   + +F    +   +  +N AVGY+N+D+  A K GI V NTP V                 R +V+ D F+R+G +      W P  F+G  + G+TIG+IG GRIG A A+   +GF M ++YY   +   +E+ + A
Sbjct:   18 MLEDEFEVEVWGDEKEI--PREILLKKVKEVDALVTMLSERIDKEVFENAPKL--RIVANYAVGYDNIDIEEATKRGIYVTNTPDVLTDATADLAFALLLATARHVVKGDRFVRSGEWKKRGVAWHPKWFLGYDVYGKTIGIIGLGRIGQAIAK-RAKGFNMRILYYSRTRKEEVERELNA 193          
BLAST of FC868555 vs. ExPASy Swiss-Prot
Match: GYAR_THEGJ (Glyoxylate reductase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=gyaR PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.601e-16
Identity = 59/181 (32.60%), Postives = 93/181 (51.38%), Query Frame = 3
Query:  129 LIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYD----GWLPNLFVGNLLKGQTIGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTA 659
            ++ +   VE+  +++ I   E ++  + D  D ++  L+E     +F    R   +  +N AVGY+NVDV  A + GI V NTP V                 RR++EAD F R+G +      W P +F+G+ + G+TIG+IG GRIG A AR   +GF M ++YY   +    E+ + A
Sbjct:   18 MLREHFEVEVWPEEREIPR-EVLLEKVRD-VDALVTMLSERIDGEVFDNAPRL--RIVANYAVGYDNVDVEEATRRGIYVTNTPDVLTNATADFAWTLLLATARRLIEADSFTRSGEWKRKGIAWHPLMFLGHDVYGKTIGIIGFGRIGQAVAR-RAKGFGMRILYYSRTRKPEAEEELKA 193          
The following BLAST results are available for this feature:
BLAST of FC868555 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
DHGY_CUCSA5.858e-10487.20Glycerate dehydrogenase OS=Cucumis sativus GN=HPR-... [more]
GYAR_KORCO1.690e-1836.81Glyoxylate reductase OS=Korarchaeum cryptofilum (s... [more]
GYAR_THELI3.764e-1841.27Glyoxylate reductase OS=Thermococcus litoralis GN=... [more]
GYAR_PYRFU4.916e-1832.82Glyoxylate reductase OS=Pyrococcus furiosus GN=gya... [more]
GYAR_PYRAB7.099e-1732.60Glyoxylate reductase OS=Pyrococcus abyssi GN=gyaR ... [more]
GYAR_THEON9.271e-1732.82Glyoxylate reductase OS=Thermococcus onnurineus (s... [more]
GYAR_PYRKO1.211e-1632.77Glyoxylate reductase OS=Pyrococcus kodakaraensis G... [more]
GYAR_THEPD2.065e-1631.96Glyoxylate reductase OS=Thermofilum pendens (strai... [more]
GYAR_PYRHO3.523e-1630.39Glyoxylate reductase OS=Pyrococcus horikoshii GN=g... [more]
GYAR_THEGJ4.601e-1632.60Glyoxylate reductase OS=Thermococcus gammatolerans... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001H02EF AbioticL1 Citrus clementina cDNA clone C31001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868555 ID=FC868555; Name=FC868555; organism=Citrus clementina; type=EST; length=666bp
ACTTGGAACTTGAAACTGCCAACTTAGCTTCAATGGCGAAGCCAGTTTCG
ATTGAAGTGTGGAACCCAAATGGAAAATACAGAGTTGTTAGTACCAAGCC
TATGCCTGGAACCCGCTGGATCAATCTCTTAATCGAACAAGATTGCCGTG
TTGAAATATGCACCCAGAAGAAAACTATACTCTCTGTTGAAGATATCATT
GCTTTGATTGGTGACAAGTGCGATGGAGTCATTGGACAGTTGACAGAGGA
CTGGGGAGAGACTTTGTTTGCTGCACTGAGTAGAGCAGGAGGAAAGGCTT
TTAGTAACATGGCTGTTGGTTACAACAATGTTGACGTTAATGCTGCTAAC
AAATATGGTATTGCTGTTGGAAACACTCCTGGAGTACTTACAGAAACAAC
AGCAGAGTTAGCAGCTTCGCTCTCTCTAGCGGCTGCAAGAAGAATTGTTG
AAGCAGATGAGTTTATGAGAGCTGGCTTATACGATGGATGGCTTCCAAAT
CTGTTCGTTGGGAACTTGCTCAAGGGACAGACTATTGGTGTGATTGGAGC
TGGTCGTATAGGATCTGCCTATGCTAGAATGATGGTTGAAGGGTTCAAAA
TGAACCTCATTTACTATGATCTTTACCAAGCTACACGCTTGGAAAAGTTT
GTCACAGCTTATGGTC
back to top