FC868560

Overview
NameFC868560
Unique NameFC868560
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length697
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9383 contig Ccv1_Contig9383:17..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: IDND_VITVI (L-idonate 5-dehydrogenase OS=Vitis vinifera GN=GSVIVT00012394001 PE=1 SV=2)

HSP 1 Score: 355.91 bits (912), Expect = 1.179e-97
Identity = 173/224 (77.23%), Postives = 195/224 (87.05%), Query Frame = 1
Query:   34 MGKGGMSQGE---KEDGEEVNMAAWLMGVNTLKIQPLELPSLGPYDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRLSV 696
            MGKGG S+     KE GEE NMAAWL+G+ TLKIQP  LPSLGPYDV VR+KAVG+CGSDVH  KT+R A+F+VK+PMVIGHECAG+IE+VGSEVK LV GDRVALEPGISC +C  C+ G+YNLC E K  GSPP +G LANQVVHP++LCFKLPDNVSLEEGAMCEPLSVG+HACRRAN+GPETNVLIMGSGPIGLVTML ARAFGAPRIV+VDVDD RL++
Sbjct:    1 MGKGGNSEDAVSGKEHGEE-NMAAWLLGIKTLKIQPYILPSLGPYDVKVRIKAVGICGSDVHHFKTMRCANFIVKKPMVIGHECAGIIEEVGSEVKNLVAGDRVALEPGISCNRCSLCRNGQYNLCREMKFFGSPPTNGSLANQVVHPSNLCFKLPDNVSLEEGAMCEPLSVGIHACRRANVGPETNVLIMGSGPIGLVTMLAARAFGAPRIVLVDVDDQRLAI 223          
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: DHSO_RAT (Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sord PE=1 SV=4)

HSP 1 Score: 210.69 bits (535), Expect = 6.126e-54
Identity = 100/203 (49.26%), Postives = 142/203 (69.95%), Query Frame = 1
Query:   85 NMAAWLMGVNTLKIQPLELPSLGPYDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRLS 693
            N++  + G   ++++   +P LGP DVL++M +VG+CGSDVH+ +  R+ DFVVK+PMV+GHE AG + KVG  VK L PGDRVA+EPG+     ++CK GRYNL P      +PP  G L     H AD C+KLPD+V+ EEGA+ EPLSVG++ACRR ++     VL+ G+GPIG+VT+L A+A GA ++V++D+   RL+
Sbjct:    9 NLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGPMVKHLKPGDRVAIEPGVPREIDEFCKIGRYNLTPSIFFCATPPDDGNLCRFYKHSADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPIGIVTLLVAKAMGASQVVVIDLSASRLA 211          
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: DHSO_MOUSE (Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=1 SV=3)

HSP 1 Score: 210.305 bits (534), Expect = 8.001e-54
Identity = 100/203 (49.26%), Postives = 141/203 (69.46%), Query Frame = 1
Query:   85 NMAAWLMGVNTLKIQPLELPSLGPYDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRLS 693
            N++  + G   ++++   +P LGP DVL++M +VG+CGSDVH+ +  R+ DFVVK+PMV+GHE AG + KVG  VK L PGDRVA+EPG+     +YCK GRYNL P      +PP  G L     H AD C+KLPD+V+ EEGA+ EPLSVG++ACRR ++     VL+ G+GP+G+VT+L A+A GA ++V+ D+   RL+
Sbjct:    9 NLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGELVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFCATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPVGMVTLLVAKAMGAAQVVVTDLSASRLT 211          
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: DHSO_PONAB (Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.328e-53
Identity = 102/203 (50.25%), Postives = 139/203 (68.47%), Query Frame = 1
Query:   85 NMAAWLMGVNTLKIQPLELPSLGPYDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRLS 693
            N++  + G   L+++   +P  GP +VL+RM +VG+CGSDVH+ +  R+ +F+VK+PMV+GHE +G +EKVGS VK L PGDRVA+EPG      ++CK GRYNL P      +PP  G L     H A  C+KLPDNV+ EEGAM EPLSVG+HACRR  +     VL+ G+GPIG+VT+L A+A GA ++V+ D+   RLS
Sbjct:    9 NLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEDGRIGNFIVKKPMVLGHEASGTVEKVGSLVKHLKPGDRVAIEPGAPRENDEFCKIGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGAMIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLS 211          
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: DHSO_HUMAN (Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=3)

HSP 1 Score: 208.764 bits (530), Expect = 2.328e-53
Identity = 101/203 (49.75%), Postives = 139/203 (68.47%), Query Frame = 1
Query:   85 NMAAWLMGVNTLKIQPLELPSLGPYDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRLS 693
            N++  + G   L+++   +P  GP +VL+RM +VG+CGSDVH+ +  R+ +F+VK+PMV+GHE +G +EKVGS VK L PGDRVA+EPG      ++CK GRYNL P      +PP  G L     H A  C+KLPDNV+ EEGA+ EPLSVG+HACRR  +     VL+ G+GPIG+VT+L A+A GA ++V+ D+   RLS
Sbjct:    9 NLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLS 211          
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: DHSO_MACFA (Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3)

HSP 1 Score: 208.379 bits (529), Expect = 3.040e-53
Identity = 100/203 (49.26%), Postives = 140/203 (68.97%), Query Frame = 1
Query:   85 NMAAWLMGVNTLKIQPLELPSLGPYDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRLS 693
            N++  + G   L+++   +P  GP +VL+RM +VG+CGSDVH+ +  R+ +F+VK+PMV+GHE +G +EKVGS VK L PGDRVA+EPG+     ++CK GRYNL P      +PP  G L     H A  C+KLPDNV+ EEGA+ EPLSVG+HACRR  +     VL+ G+GPIG+V++L A+A GA ++V+ D+   RLS
Sbjct:    9 NLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEEGRIGNFIVKKPMVLGHEASGTVEKVGSLVKHLKPGDRVAIEPGVPRENDEFCKSGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHRVLVCGAGPIGVVSLLVAKAMGAAQVVVTDLSAPRLS 211          
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: DHSO_BOVIN (Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3)

HSP 1 Score: 207.608 bits (527), Expect = 5.186e-53
Identity = 101/203 (49.75%), Postives = 140/203 (68.97%), Query Frame = 1
Query:   85 NMAAWLMGVNTLKIQPLELPSLGPYDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRLS 693
            N++  + G   L+++   +P  GP +VL++M +VG+CGSDVH+ +  R+ DFVVK+PMV+GHE +G + KVGS V+ L PGDRVA+EPG      ++CK GRYNL P      +PP  G L     H A+ C+KLPDNV+ EEGA+ EPLSVG+HACRRA +     VL+ G+GPIGLV++L A+A GA ++V+ D+   RLS
Sbjct:    8 NLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFVVKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPTIFFCATPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVSLLAAKAMGAAQVVVTDLSASRLS 210          
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: DHSO_SHEEP (Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 9.780e-52
Identity = 100/203 (49.26%), Postives = 139/203 (68.47%), Query Frame = 1
Query:   85 NMAAWLMGVNTLKIQPLELPSLGPYDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRLS 693
            N++  + G   L+++   +P  GP +VL++M +VG+CGSDVH+ +  R+ DFVVK+PMV+GHE +G + KVGS V+ L PGDRVA++PG      ++CK GRYNL P      +PP  G L     H A+ C+KLPDNV+ EEGA+ EPLSVG+HACRRA +     VL+ G+GPIGLV +L A+A GA ++V+ D+   RLS
Sbjct:    7 NLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQG-RIGDFVVKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIQPGAPRQTDEFCKIGRYNLSPTIFFCATPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVNLLAAKAMGAAQVVVTDLSASRLS 208          
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: DHSO_BACSU (Sorbitol dehydrogenase OS=Bacillus subtilis GN=gutB PE=1 SV=3)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 88/200 (44.00%), Postives = 132/200 (66.00%), Query Frame = 1
Query:   91 AAWLMGVNTLKIQPLELPSLGPYDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRL 690
            AA +     +KI+ L +P +   +VL+++ AVG+CGSD+H+    R+ ++VV++P ++GHECAG I  VGS V     GDRVA+EPG++C +C+ CK GRYNLCP+ + L +PPV G     +    D  F +PD++S EE A+ EP SVG+HA  R  + P + + IMG GP+GL+ +  A+AFGA  I++ D++  RL
Sbjct:   11 AAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEKPFILGHECAGEIAAVGSSVDQFKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFLATPPVDGAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAARTKLQPGSTIAIMGMGPVGLMAVAAAKAFGAGTIIVTDLEPLRL 210          
BLAST of FC868560 vs. ExPASy Swiss-Prot
Match: DHSO_SCHPO (Putative sorbitol dehydrogenase OS=Schizosaccharomyces pombe GN=tms1 PE=2 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 8.019e-46
Identity = 87/178 (48.88%), Postives = 117/178 (65.73%), Query Frame = 1
Query:  157 YDVLVRMKAVGVCGSDVHFLKTLRLADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWQCDYCKGGRYNLCPESKGLGSPPVHGCLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIGPETNVLIMGSGPIGLVTMLGARAFGAPRIVIVDVDDYRL 690
            + V V +KA G+CGSDVH+ K   + DF++K+PM++GHE AGV+ +VG  V +L PGD VA+EPG  C  CDYC+ GRYNLCP  +   +PP  G L    +   D C KLP  +S+EEGA+ EP+SV VHA  R N+   + VL+MG G +GL+ M  A+A+GA  IV VD    R+
Sbjct:   30 HQVKVAIKATGICGSDVHYWKEGGIGDFILKKPMILGHESAGVVVEVGKGVSSLKPGDPVAVEPGCVCRLCDYCRSGRYNLCPHMEFAATPPYDGTLRTYYITTEDFCTKLPKQISVEEGALFEPMSVAVHAMTRGNLKCGSRVLVMGCGTVGLLMMAVAKAYGAIDIVAVDASPSRV 207          
The following BLAST results are available for this feature:
BLAST of FC868560 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 320
Match NameE-valueIdentityDescription
IDND_VITVI1.179e-9777.23L-idonate 5-dehydrogenase OS=Vitis vinifera GN=GSV... [more]
DHSO_RAT6.126e-5449.26Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sor... [more]
DHSO_MOUSE8.001e-5449.26Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=... [more]
DHSO_PONAB2.328e-5350.25Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=... [more]
DHSO_HUMAN2.328e-5349.75Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=... [more]
DHSO_MACFA3.040e-5349.26Sorbitol dehydrogenase OS=Macaca fascicularis GN=S... [more]
DHSO_BOVIN5.186e-5349.75Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 ... [more]
DHSO_SHEEP9.780e-5249.26Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 ... [more]
DHSO_BACSU9.154e-5044.00Sorbitol dehydrogenase OS=Bacillus subtilis GN=gut... [more]
DHSO_SCHPO8.019e-4648.88Putative sorbitol dehydrogenase OS=Schizosaccharom... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001H08EF AbioticL1 Citrus clementina cDNA clone C31001H08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868560 ID=FC868560|Name=FC868560|organism=Citrus clementina|type=EST|length=697bp
GGCACTTGTGTTTTTGAAGAGTGCAAAGCAAATATGGGCAAGGGAGGGAT
GTCACAAGGAGAAAAGGAAGATGGAGAAGAAGTTAACATGGCAGCTTGGC
TTATGGGTGTCAACACCCTCAAGATTCAGCCTTTGGAGCTTCCTTCTCTG
GGACCTTATGATGTTTTAGTCAGGATGAAAGCCGTTGGTGTTTGTGGAAG
TGATGTGCATTTTCTCAAGACCTTGAGGCTTGCCGATTTTGTAGTGAAAG
AGCCTATGGTGATCGGGCATGAGTGTGCTGGGGTCATAGAGAAGGTGGGA
AGCGAGGTGAAGACTTTGGTGCCCGGTGACCGTGTGGCCCTGGAACCAGG
GATCAGCTGCTGGCAATGTGATTACTGCAAAGGAGGTCGATACAATTTGT
GTCCAGAGTCGAAAGGTCTTGGAAGTCCGCCAGTTCATGGTTGTCTGGCT
AATCAGGTGGTGCATCCTGCAGACCTATGTTTTAAGCTGCCCGACAATGT
CAGCCTGGAGGAAGGGGCTATGTGTGAGCCCTTGAGTGTTGGTGTTCATG
CCTGCCGCCGTGCCAATATCGGTCCTGAGACAAATGTGCTTATCATGGGA
TCAGGGCCCATAGGACTTGTCACAATGCTAGGAGCTCGTGCTTTTGGAGC
TCCTAGAATTGTCATTGTGGATGTGGATGACTATCGTTTATCTGTTG
back to top