FC868612

Overview
NameFC868612
Unique NameFC868612
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15182 contig Ccv1_Contig15182:143..846. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCE_SOLLC (Glutamate decarboxylase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.510e-108
Identity = 187/230 (81.30%), Postives = 206/230 (89.57%), Query Frame = 1
Query:    1 EILSSTSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPI 690
            E L  T ASRYV+  +P+FKMP  SMPKEAAYQ++NDELMLDGNPRLNLASFV+TWMEPECDKL+M+SINKNYVDMDEYPVTTELQNRCVNM+AHLF+ PV DD+TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKP+DKPNIVTGANVQVCWEKFARYF           GYYVM+P KAVE+VDENTICVAAILGSTLTGEFEDVKLL++LLTKKN+ETGW+TPI
Sbjct:   13 ESLHCTFASRYVQEPLPKFKMPKKSMPKEAAYQIVNDELMLDGNPRLNLASFVSTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMLAHLFHAPVGDDETAVGVGTVGSSEAIMLAGLAFKRKWQSKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELKEVKLKEGYYVMDPAKAVEIVDENTICVAAILGSTLTGEFEDVKLLNELLTKKNKETGWETPI 242          
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCE_PETHY (Glutamate decarboxylase OS=Petunia hybrida GN=GAD PE=1 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 9.784e-108
Identity = 189/228 (82.89%), Postives = 202/228 (88.60%), Query Frame = 1
Query:    7 LSSTSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPI 690
            + ST ASRYVR ++PRFKMPDNS+PKEAAYQ+INDELMLDGNPRLNLASFVTTWMEPECDKL+M SINKNYVDMDEYPVTTELQNRCVNMIAHLFN P+ D +TAVGVGTVGSSEAIMLAGLAFKRKWQ K K QGKP DKPNIVTGANVQVCWEKFARYF           GYYVM+P KAVE+VDENTICVAAILGSTL GEFEDVK L+DLL +KN+ETGWDTPI
Sbjct:   14 IHSTFASRYVRTSLPRFKMPDNSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEDGETAVGVGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPCDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTPI 241          
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCE1_ARATH (Glutamate decarboxylase 1 OS=Arabidopsis thaliana GN=GAD1 PE=1 SV=2)

HSP 1 Score: 388.652 bits (997), Expect = 1.669e-107
Identity = 186/226 (82.30%), Postives = 204/226 (90.27%), Query Frame = 1
Query:   13 STSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPI 690
            ST ASRYVR ++PRFKMP+NS+PKEAAYQ+INDELMLDGNPRLNLASFVTTWMEPECDKL+M+SINKNYVDMDEYPVTTELQNRCVNMIAHLFN P+ + +TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKP DKPNIVTGANVQVCWEKFARYF           GYYVM+P +AV++VDENTICVAAILGSTL GEFEDVKLL+DLL +KN+ETGWDTPI
Sbjct:   16 STFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTPI 241          
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCE2_ARATH (Glutamate decarboxylase 2 OS=Arabidopsis thaliana GN=GAD2 PE=1 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.023e-102
Identity = 177/230 (76.96%), Postives = 198/230 (86.09%), Query Frame = 1
Query:    1 EILSSTSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPI 690
            E + +   SRYVR  +P++++ +NS+PK+AAYQ+I DELMLDGNPRLNLASFVTTWMEPECDKL+M SINKNYVDMDEYPVTTELQNRCVN+IA LFN P+ + +TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKPYDKPNIVTGANVQVCWEKFARYF           GYYVM+P KA E+VDENTICVAAILGSTL GEFEDVK L+DLL KKNEETGW+TPI
Sbjct:   11 ESVCTMFGSRYVRTTLPKYEIGENSIPKDAAYQIIKDELMLDGNPRLNLASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNIIARLFNAPLEESETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVNLSEGYYVMDPDKAAEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVKKNEETGWNTPI 240          
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCEB_SHIFL (Glutamate decarboxylase beta OS=Shigella flexneri GN=gadB PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.293e-48
Identity = 98/227 (43.17%), Postives = 135/227 (59.47%), Query Frame = 1
Query:    1 EILSSTSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWD 681
            E+L S   ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D
Sbjct:   12 ELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGID 237          
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCEB_ECOLI (Glutamate decarboxylase beta OS=Escherichia coli (strain K12) GN=gadB PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.293e-48
Identity = 98/227 (43.17%), Postives = 135/227 (59.47%), Query Frame = 1
Query:    1 EILSSTSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWD 681
            E+L S   ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D
Sbjct:   12 ELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGID 237          
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCEB_ECO57 (Glutamate decarboxylase beta OS=Escherichia coli O157:H7 GN=gadB PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.293e-48
Identity = 98/227 (43.17%), Postives = 135/227 (59.47%), Query Frame = 1
Query:    1 EILSSTSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWD 681
            E+L S   ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D
Sbjct:   12 ELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGID 237          
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCEA_SHIFL (Glutamate decarboxylase alpha OS=Shigella flexneri GN=gadA PE=2 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 2.293e-48
Identity = 98/227 (43.17%), Postives = 135/227 (59.47%), Query Frame = 1
Query:    1 EILSSTSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWD 681
            E+L S   ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D
Sbjct:   12 ELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGID 237          
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCEA_ECOLI (Glutamate decarboxylase alpha OS=Escherichia coli (strain K12) GN=gadA PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.293e-48
Identity = 98/227 (43.17%), Postives = 135/227 (59.47%), Query Frame = 1
Query:    1 EILSSTSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWD 681
            E+L S   ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D
Sbjct:   12 ELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGID 237          
BLAST of FC868612 vs. ExPASy Swiss-Prot
Match: DCEA_ECOL6 (Glutamate decarboxylase alpha OS=Escherichia coli O6 GN=gadA PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.293e-48
Identity = 98/227 (43.17%), Postives = 135/227 (59.47%), Query Frame = 1
Query:    1 EILSSTSASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWD 681
            E+L S   ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D
Sbjct:   12 ELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGID 237          
The following BLAST results are available for this feature:
BLAST of FC868612 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
DCE_SOLLC1.510e-10881.30Glutamate decarboxylase OS=Solanum lycopersicum PE... [more]
DCE_PETHY9.784e-10882.89Glutamate decarboxylase OS=Petunia hybrida GN=GAD ... [more]
DCE1_ARATH1.669e-10782.30Glutamate decarboxylase 1 OS=Arabidopsis thaliana ... [more]
DCE2_ARATH8.023e-10276.96Glutamate decarboxylase 2 OS=Arabidopsis thaliana ... [more]
DCEB_SHIFL2.293e-4843.17Glutamate decarboxylase beta OS=Shigella flexneri ... [more]
DCEB_ECOLI2.293e-4843.17Glutamate decarboxylase beta OS=Escherichia coli (... [more]
DCEB_ECO572.293e-4843.17Glutamate decarboxylase beta OS=Escherichia coli O... [more]
DCEA_SHIFL2.293e-4843.17Glutamate decarboxylase alpha OS=Shigella flexneri... [more]
DCEA_ECOLI2.293e-4843.17Glutamate decarboxylase alpha OS=Escherichia coli ... [more]
DCEA_ECOL62.293e-4843.17Glutamate decarboxylase alpha OS=Escherichia coli ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31002F05EF AbioticL1 Citrus clementina cDNA clone C31002F05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868612 ID=FC868612; Name=FC868612; organism=Citrus clementina; type=EST; length=704bp
GAGATTTTGAGCTCCACATCTGCTTCAAGATATGTCCGTGCTGCTATTCC
CAGATTCAAGATGCCAGATAATTCAATGCCAAAGGAGGCAGCCTATCAGG
TAATAAATGATGAGCTGATGTTAGATGGAAATCCAAGGCTGAACTTGGCA
TCTTTTGTGACCACTTGGATGGAGCCCGAGTGTGATAAGCTTGTCATGGC
TTCGATTAATAAAAACTATGTTGACATGGATGAATACCCTGTAACCACAG
AGCTCCAGAATCGGTGTGTGAATATGATTGCCCACCTATTTAATACTCCA
GTTGCGGATGACAAGACTGCAGTGGGCGTGGGGACTGTAGGTTCATCAGA
GGCAATAATGCTTGCTGGCTTGGCTTTTAAAAGGAAGTGGCAGCAGAAGA
GAAAAGAGCAAGGCAAACCCTATGATAAGCCCAATATAGTCACTGGAGCT
AATGTGCAGGTATGCTGGGAGAAATTTGCGAGGTACTTTGAGGTTGAGCT
GAAGGAGGTGAAACTGGAAGAGGGATATTATGTGATGAATCCTGTGAAAG
CTGTTGAGTTGGTAGATGAGAACACCATTTGTGTTGCAGCCATTCTGGGA
TCAACCTTGACGGGAGAATTTGAGGATGTTAAGCTTCTTCATGACCTCCT
CACCAAAAAGAATGAGGAGACCGGTTGGGACACCCCCATCATGTTGATGC
TGCT
back to top