FC868641

Overview
NameFC868641
Unique NameFC868641
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length625
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: HAL3A_ARATH (Phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana GN=HAL3A PE=1 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 4.060e-56
Identity = 100/122 (81.97%), Postives = 114/122 (93.44%), Query Frame = 1
Query:  259 DREAMQVNTGLRKPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRA 624
            DR+ M+VNT  RKPR+LLAASGSVAAIKFGNLCHCF+EWAEVRAV TKSSLHF+D+ +LP++V  YTDEDEW++WNKIGD VLHIELRRWAD++VIAPLSANTLGKIAGGLCDNLLTCI+RA
Sbjct:    7 DRQDMEVNTTPRKPRVLLAASGSVAAIKFGNLCHCFTEWAEVRAVVTKSSLHFLDKLSLPQEVTLYTDEDEWSSWNKIGDPVLHIELRRWADVLVIAPLSANTLGKIAGGLCDNLLTCIIRA 128          
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: HAL3B_ARATH (Probable phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana GN=HAL3B PE=2 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 2.723e-52
Identity = 95/118 (80.51%), Postives = 110/118 (93.22%), Query Frame = 1
Query:  271 MQVNTGLRKPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRA 624
            M+V+T  RKPRILLAASGSVA+IKF NLCHCFSEWAEV+AVA+KSSL+F+D+ +LP++V  YTDEDEW++WNKIGD VLHIELRRWAD+M+IAPLSANTL KIAGGLCDNLLTCIVRA
Sbjct:    3 MEVDTVTRKPRILLAASGSVASIKFSNLCHCFSEWAEVKAVASKSSLNFVDKPSLPQNVTLYTDEDEWSSWNKIGDPVLHIELRRWADVMIIAPLSANTLAKIAGGLCDNLLTCIVRA 120          
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: COAC_MOUSE (Phosphopantothenoylcysteine decarboxylase OS=Mus musculus GN=Ppcdc PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 8.256e-25
Identity = 57/113 (50.44%), Postives = 75/113 (66.37%), Query Frame = 1
Query:  292 RKPRILLAASGSVAAIKFGNLCHCFSE--WAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRA 624
            RK R+L+  +GSVAA+K   L     +    EV  V T+ + HF     +P  V  Y+D DEW  W +  D VLHI+LRRWAD+M++APL ANTLGK+A G+CDNLLTC++RA
Sbjct:   16 RKFRVLVGVTGSVAALKLPLLVSKLLDVPGLEVTVVTTERAKHFYSPQDVP--VTLYSDADEWEMWKRRSDPVLHIDLRRWADLMLVAPLDANTLGKVASGICDNLLTCVIRA 126          
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: COAC_HUMAN (Phosphopantothenoylcysteine decarboxylase OS=Homo sapiens GN=PPCDC PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.557e-23
Identity = 55/113 (48.67%), Postives = 73/113 (64.60%), Query Frame = 1
Query:  292 RKPRILLAASGSVAAIKFGNLCHCFSE--WAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRA 624
            RK  +L+  +GSVAA+K   L     +    EV  V T+ + HF     +P  V  Y+D DEW  W    D VLHI+LRRWAD++++APL ANTLGK+A G+CDNLLTC++RA
Sbjct:   16 RKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIP--VTLYSDADEWEMWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRA 126          
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: VHS3_YEAST (Protein VHS3 OS=Saccharomyces cerevisiae GN=VHS3 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.781e-19
Identity = 43/64 (67.19%), Postives = 52/64 (81.25%), Query Frame = 1
Query:  433 LPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRA 624
            LP  + F+TD+DEW  W +  D VLHIELRRWADI+V+APL+ANTL KIA GLCDNLLT ++RA
Sbjct:  434 LPAHIQFWTDQDEWDVWRQRTDPVLHIELRRWADILVVAPLTANTLAKIALGLCDNLLTSVIRA 497          
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: TYSY_SCHPO (Probable thymidylate synthase OS=Schizosaccharomyces pombe GN=SPAC15E1.04 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.183e-19
Identity = 50/113 (44.25%), Postives = 73/113 (64.60%), Query Frame = 1
Query:  295 KPRILLAASGSVAAIKFGNLCHCFSEW--AEVRAVATKSSLHFIDRAALPK-DVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRA 624
            K  IL+AA+GSVAAIK   +      +   +V+ V T  + +F+++  L    V  Y + D+W  W+ +   + HIELRRWA +++IAPLSANT+ K+A GLCDNLLT ++RA
Sbjct:   30 KYHILVAATGSVAAIKLTLIVKSLLTYKGVDVQVVLTDPARNFVEKEDLTALGVNVYNNADDWKNWDGLECPITHIELRRWAHLLLIAPLSANTMAKMANGLCDNLLTSLIRA 142          
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: SIS2_YEAST (Protein SIS2 OS=Saccharomyces cerevisiae GN=SIS2 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 8.841e-19
Identity = 42/64 (65.62%), Postives = 51/64 (79.69%), Query Frame = 1
Query:  433 LPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRA 624
            LP  +  +TD+DEW  W +  D VLHIELRRWADI+V+APL+ANTL KIA GLCDNLLT ++RA
Sbjct:  353 LPPHIQLWTDQDEWDAWKQRTDPVLHIELRRWADILVVAPLTANTLSKIALGLCDNLLTSVIRA 416          
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: SIS2_CANTR (Protein SIS2 OS=Candida tropicalis GN=SIS2 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.277e-17
Identity = 46/91 (50.55%), Postives = 61/91 (67.03%), Query Frame = 1
Query:  367 SEWAEVRAVATKSSLHFIDRAALP-----KDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRA 624
            S+   ++ + TKSS +F+    L      K V  +TD DEW TW    D VLHIELRRWADI+++ PL+ANTL KI+ G+CDNLLT ++RA
Sbjct:  296 SDKISIQVILTKSSENFLLPETLNVLENVKKVRVWTDIDEWTTWKTRLDPVLHIELRRWADILLVCPLTANTLAKISLGICDNLLTNVIRA 386          
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: COAC_DICDI (Putative phosphopantothenoylcysteine decarboxylase OS=Dictyostelium discoideum GN=ppcdc PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 8.275e-17
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 1
Query:  295 KPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKSSLHFI---DRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRA 624
            K  ++L  +GSVA IK   L     +   +  + T++SL F+   D   +      Y D+DEW   + +  S LHI+LR WA+ ++I+P SANTLGKI+ GLCDNLLT ++RA
Sbjct:   12 KKNLILGLTGSVATIKAKLLVEQLIQHFNLIVIPTETSLKFLSDQDFEFISSKCKIYKDKDEWENVDLLKRSALHIDLRNWANSILISPCSANTLGKISNGLCDNLLTSLIRA 124          
BLAST of FC868641 vs. ExPASy Swiss-Prot
Match: YKI8_YEAST (Uncharacterized protein YKL088W OS=Saccharomyces cerevisiae GN=YKL088W PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.477e-15
Identity = 55/155 (35.48%), Postives = 80/155 (51.61%), Query Frame = 1
Query:  232 MAYSEPTSTDREAMQVNTGLRKP-------------RILLAASGSVAAIK----FGNLCHCFS-EWAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWA--TWNKIGDS-----VLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVR 621
            ++ +  T  ++E +   TG R P              IL+ A+GSVA IK       L   +  E   ++ + TK + HF+    +   V  + +ED W     NK   S     +LH ELR+WADI +IAPLSANTL K+A G+C+NLLT ++R
Sbjct:  274 LSANNSTHKNKEVITAPTGPRVPFTEFFQKEDDKKFHILIGATGSVATIKVPLIIDKLFKIYGPEKISIQLIVTKPAEHFLKGLKMSTHVKIWREEDAWVFDAVNKNDTSLSLNLILHHELRKWADIFLIAPLSANTLAKLANGICNNLLTSVMR 428          
The following BLAST results are available for this feature:
BLAST of FC868641 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
HAL3A_ARATH4.060e-5681.97Phosphopantothenoylcysteine decarboxylase OS=Arabi... [more]
HAL3B_ARATH2.723e-5280.51Probable phosphopantothenoylcysteine decarboxylase... [more]
COAC_MOUSE8.256e-2550.44Phosphopantothenoylcysteine decarboxylase OS=Mus m... [more]
COAC_HUMAN1.557e-2348.67Phosphopantothenoylcysteine decarboxylase OS=Homo ... [more]
VHS3_YEAST1.781e-1967.19Protein VHS3 OS=Saccharomyces cerevisiae GN=VHS3 P... [more]
TYSY_SCHPO5.183e-1944.25Probable thymidylate synthase OS=Schizosaccharomyc... [more]
SIS2_YEAST8.841e-1965.63Protein SIS2 OS=Saccharomyces cerevisiae GN=SIS2 P... [more]
SIS2_CANTR1.277e-1750.55Protein SIS2 OS=Candida tropicalis GN=SIS2 PE=3 SV... [more]
COAC_DICDI8.275e-1741.59Putative phosphopantothenoylcysteine decarboxylase... [more]
YKI8_YEAST3.477e-1535.48Uncharacterized protein YKL088W OS=Saccharomyces c... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31003A01EF AbioticL1 Citrus clementina cDNA clone C31003A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868641 ID=FC868641; Name=FC868641; organism=Citrus clementina; type=EST; length=625bp
TTGCTTTGTTTGTCAACGTCGCGGCTGCCGCTCTCTACTTCCCACCCCCC
TCGGACTCTCTCTACTCTCTAGGTCTAGGCTGCCTCCAAGCCAGCGACCG
TTAGTCGTCGGTTTCCACACTCCGACGCTGCGACGTCGATTGTTGTCTCC
CCTCCGCCACGCCACTCGTGGATTGCTGTTCTACCACCGCCGGCCGCGGC
TGATCTGATTCATCTCATCTCATGATTGATTATGGCATACTCTGAACCTA
CAAGTACCGATAGGGAGGCGATGCAGGTCAATACTGGTCTGAGGAAACCC
CGTATTTTACTTGCTGCAAGTGGAAGTGTAGCTGCAATAAAATTTGGGAA
TCTCTGTCATTGTTTTTCTGAGTGGGCGGAAGTAAGAGCGGTGGCCACAA
AGTCCTCTCTACACTTCATTGATAGAGCAGCGCTTCCTAAGGATGTGATC
TTTTACACAGACGAGGATGAATGGGCCACCTGGAACAAAATAGGTGATAG
CGTTCTTCACATCGAGCTCCGCAGATGGGCTGATATTATGGTTATTGCTC
CCCTGTCAGCAAACACACTTGGCAAGATTGCAGGTGGATTGTGTGACAAT
CTGCTGACATGCATTGTGCGGGCAT
back to top