FC868645

Overview
NameFC868645
Unique NameFC868645
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length746
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868645 vs. ExPASy Swiss-Prot
Match: K6PF7_ARATH (6-phosphofructokinase 7 OS=Arabidopsis thaliana GN=PFK7 PE=1 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 4.409e-61
Identity = 86/105 (81.90%), Postives = 96/105 (91.43%), Query Frame = 2
Query:  335 SNNGNSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGL 649
            S+  +++ KIV GP GY+L+DVPHL DY+PDLPTYPNPLQDNPAYSVVKQYFVH DD+VP+KVVVHKD PRG HFRRAGPRQKVYFESDEV+ACIVTCGGLCPGL
Sbjct:    2 SSPRSNKPKIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVHADDSVPEKVVVHKDGPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGL 106          

HSP 2 Score: 62.7734 bits (151), Expect = 4.409e-61
Identity = 29/37 (78.38%), Postives = 32/37 (86.49%), Query Frame = 1
Query:  634 LMPWTHTVIREIVYSLYYMYGVKRVLGIDGGYRGFYA 744
            L P  +TVIRE+V SL YMYGVKR+LGIDGGYRGFYA
Sbjct:  102 LCPGLNTVIREVVSSLSYMYGVKRILGIDGGYRGFYA 138          
BLAST of FC868645 vs. ExPASy Swiss-Prot
Match: K6PF3_ARATH (6-phosphofructokinase 3 OS=Arabidopsis thaliana GN=PFK3 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 8.161e-60
Identity = 85/101 (84.16%), Postives = 92/101 (91.09%), Query Frame = 2
Query:  347 NSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGL 649
            +S+ KI+ G  GYVLEDVPHLSDY+P LPTYPNPLQDNPAYSVVKQYFV  DD+VPQK+VVHKD PRG HFRRAGPRQKVYFESDEV+ACIVTCGGLCPGL
Sbjct:    6 SSKPKIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGL 106          

HSP 2 Score: 63.1586 bits (152), Expect = 8.161e-60
Identity = 30/37 (81.08%), Postives = 32/37 (86.49%), Query Frame = 1
Query:  634 LMPWTHTVIREIVYSLYYMYGVKRVLGIDGGYRGFYA 744
            L P  +TVIREIV SL YMYGVKR+LGIDGGYRGFYA
Sbjct:  102 LCPGLNTVIREIVSSLSYMYGVKRILGIDGGYRGFYA 138          
BLAST of FC868645 vs. ExPASy Swiss-Prot
Match: K6PF1_ARATH (6-phosphofructokinase 1 OS=Arabidopsis thaliana GN=PFK1 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.388e-59
Identity = 88/106 (83.02%), Postives = 94/106 (88.68%), Query Frame = 2
Query:  332 ASNNGNSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGL 649
            +S+  NS RKIVTGPAGY+LEDVPH SD  PD PTYPNPLQDN AYSVVKQYFV  DDTVPQK+VVH DSPRGTHFRRAGPRQ+VYFESD+V ACIVTCGGLCPGL
Sbjct:    2 SSSVPNSDRKIVTGPAGYILEDVPHFSDDFPDHPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPDSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGL 107          

HSP 2 Score: 61.6178 bits (148), Expect = 1.388e-59
Identity = 29/37 (78.38%), Postives = 31/37 (83.78%), Query Frame = 1
Query:  634 LMPWTHTVIREIVYSLYYMYGVKRVLGIDGGYRGFYA 744
            L P  +TVIREIV  L YMYGVKR+LGIDGGYRGFYA
Sbjct:  103 LCPGLNTVIREIVCGLSYMYGVKRILGIDGGYRGFYA 139          
BLAST of FC868645 vs. ExPASy Swiss-Prot
Match: K6PF6_ARATH (6-phosphofructokinase 6 OS=Arabidopsis thaliana GN=PFK6 PE=1 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 7.969e-54
Identity = 85/106 (80.19%), Postives = 92/106 (86.79%), Query Frame = 2
Query:  332 ASNNGNSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGL 649
            ASN  + Q K+V GPAGYVLEDVPHLSDYI DLPTYPNPLQ N AYSVV+QYFV  DDTV +K+VVHKDSPRGTHFRRAGPRQKVYF+  +V ACIVTCGGLCPGL
Sbjct:    2 ASNGVDEQIKLVEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDEDDTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPSDVRACIVTCGGLCPGL 107          

HSP 2 Score: 50.447 bits (119), Expect = 7.969e-54
Identity = 22/37 (59.46%), Postives = 29/37 (78.38%), Query Frame = 1
Query:  634 LMPWTHTVIREIVYSLYYMYGVKRVLGIDGGYRGFYA 744
            L P  +TVIREIV  L++MYGV  V+G+D G+RGFY+
Sbjct:  103 LCPGLNTVIREIVCGLHFMYGVTEVIGVDCGFRGFYS 139          
BLAST of FC868645 vs. ExPASy Swiss-Prot
Match: K6PF4_ARATH (6-phosphofructokinase 4, chloroplastic OS=Arabidopsis thaliana GN=PFK4 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.761e-41
Identity = 60/90 (66.67%), Postives = 76/90 (84.44%), Query Frame = 2
Query:  380 GYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGL 649
            G+VLEDVPHL+ ++PDLP+YPNPL+++ AY++VK+ FV  +D V Q +VV K S RG HFRRAGPR++VYF SDEV ACIVTCGGLCPG+
Sbjct:   68 GFVLEDVPHLTKFLPDLPSYPNPLKESQAYAIVKRTFVSSEDVVAQNIVVQKGSKRGVHFRRAGPRERVYFRSDEVKACIVTCGGLCPGI 157          

HSP 2 Score: 50.8322 bits (120), Expect = 2.761e-41
Identity = 24/37 (64.86%), Postives = 27/37 (72.97%), Query Frame = 1
Query:  634 LMPWTHTVIREIVYSLYYMYGVKRVLGIDGGYRGFYA 744
            L P  +TVIREIV  L  MYGV  +LGI GGYRGFY+
Sbjct:  153 LCPGINTVIREIVCGLNNMYGVNNILGIQGGYRGFYS 189          
BLAST of FC868645 vs. ExPASy Swiss-Prot
Match: K6PF2_ARATH (6-phosphofructokinase 2 OS=Arabidopsis thaliana GN=PFK2 PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 7.322e-16
Identity = 27/71 (38.03%), Postives = 40/71 (56.34%), Query Frame = 2
Query:  443 NPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKD--SPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGL 649
            NPL+DNP +     +++   D +  +V       S     + RAGPR+++ +E   V A IVTCGGLCPG+
Sbjct:   21 NPLEDNPYFHPSNGFYITPSDVILAQVAYDHSAHSQSRVAYHRAGPRREIMYEPSAVKAAIVTCGGLCPGM 91          

HSP 2 Score: 46.9802 bits (110), Expect = 7.322e-16
Identity = 20/37 (54.05%), Postives = 27/37 (72.97%), Query Frame = 1
Query:  634 LMPWTHTVIREIVYSLYYMYGVKRVLGIDGGYRGFYA 744
            L P  +TVIRE+V  L+ +YGV+ + GI  GYRGFY+
Sbjct:   87 LCPGMNTVIRELVVGLWELYGVREIYGIPAGYRGFYS 123          
BLAST of FC868645 vs. ExPASy Swiss-Prot
Match: K6PF5_ARATH (6-phosphofructokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PFK5 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 8.961e-12
Identity = 35/109 (32.11%), Postives = 51/109 (46.79%), Query Frame = 2
Query:  398 VPHLSDYIPDLPTYPNPL---QDNPAYSVVKQY--------FVHVDDTVPQKVVVHKDSPRGTH--------------FRRAGPRQKVYFESDEVYACIVTCGGLCPGL 649
            +PH++D +PD     +       +P    V  Y        +++ +D V  KV+ +  SP                    RAGPR+K+YF  +EV A I+TCGGLCPGL
Sbjct:   87 IPHITDVLPDAEAIRSTFCLKMRSPTEDFVGGYPSDEEWHGYINNNDRVLLKVISYS-SPTSAGAECLDHDCSWVEQWIHRAGPREKIYFRPEEVKAAIITCGGLCPGL 194          

HSP 2 Score: 35.8094 bits (81), Expect = 8.961e-12
Identity = 19/35 (54.29%), Postives = 24/35 (68.57%), Query Frame = 1
Query:  634 LMPWTHTVIREIVYSLYYMYGVKRVLGIDGGYRGF 738
            L P  + VIR IV +L  +YGVK ++GI  GYRGF
Sbjct:  190 LCPGLNDVIRHIVITLE-IYGVKNIVGIPFGYRGF 223          
The following BLAST results are available for this feature:
BLAST of FC868645 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
K6PF7_ARATH4.409e-6181.906-phosphofructokinase 7 OS=Arabidopsis thaliana GN... [more]
K6PF3_ARATH8.161e-6084.166-phosphofructokinase 3 OS=Arabidopsis thaliana GN... [more]
K6PF1_ARATH1.388e-5983.026-phosphofructokinase 1 OS=Arabidopsis thaliana GN... [more]
K6PF6_ARATH7.969e-5480.196-phosphofructokinase 6 OS=Arabidopsis thaliana GN... [more]
K6PF4_ARATH2.761e-4166.676-phosphofructokinase 4, chloroplastic OS=Arabidop... [more]
K6PF2_ARATH7.322e-1638.036-phosphofructokinase 2 OS=Arabidopsis thaliana GN... [more]
K6PF5_ARATH8.961e-1232.116-phosphofructokinase 5, chloroplastic OS=Arabidop... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31003A05EF AbioticL1 Citrus clementina cDNA clone C31003A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868645 ID=FC868645; Name=FC868645; organism=Citrus clementina; type=EST; length=746bp
GACTTTTCGCACAAAACAGCCTTTCAAACCAACTAAACATTTACGTAGCT
GTTTCTAATTTTTTTAATTTTTTCTTTTACTTTGGTCAAAAACACTCTGG
TTCTTGCTTGTTTCCTATAAATATGGATTCCTATTGTTCGTTTTCTTTTG
AATGGACTCAGTAGCTCTATCATCACCCTCACCATCACCCTCAACTTCAA
CTTCTTCTTTGAAATCGCGTTTCCTGCAAAAGCCTTCCCAGAACTCGAAG
CAGTTGTCATCTTCGGTCAGTTTTAGTTCGAGTTCGTGTTCCGATTTTCG
ATCTCCGACAAAAGCTATTTCGATGGCGGCGGCATCCAACAATGGAAACT
CACAGCGAAAGATTGTGACTGGTCCTGCTGGTTATGTTCTTGAAGATGTT
CCTCATTTGTCTGATTATATCCCCGATCTTCCTACATATCCGAATCCGCT
GCAAGACAATCCTGCATATTCTGTTGTTAAGCAATATTTTGTTCATGTGG
ATGACACGGTACCACAAAAGGTTGTTGTTCATAAGGATAGTCCAAGAGGG
ACTCACTTCCGAAGAGCTGGACCTCGTCAAAAGGTGTATTTTGAGTCAGA
TGAAGTTTATGCTTGTATCGTGACATGTGGTGGCTTATGCCCTGGACTCA
CACGGTGATTAGAGAGATAGTTTACAGTCTTTACTACATGTATGGAGTGA
AGAGAGTGCTGGGAATTGATGGAGGATACAGGGGCTTTTATGCTAA
back to top