FC868664

Overview
NameFC868664
Unique NameFC868664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA_HELAN (Catalase OS=Helianthus annuus PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 4.368e-57
Identity = 91/111 (81.98%), Postives = 96/111 (86.49%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P DVTK WPEDI PLQPVGRLVLNKNIDNFFAENE LAF P I+VPGIYYS+DK+LQ RIF+Y DTQRHRLGPNYL LP NAPKC H NNHYDGFMNFMHRDEE+   YFP
Sbjct:  286 PLDVTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEI--DYFP 394          

HSP 2 Score: 45.4394 bits (106), Expect = 4.368e-57
Identity = 18/24 (75.00%), Postives = 21/24 (87.50%), Query Frame = 2
Query:   14 HPEWKLYIQTIDPDHEDQFVSDPL 85
            +PEWKL+IQTIDPDHED+   DPL
Sbjct:  264 YPEWKLFIQTIDPDHEDRLDFDPL 287          
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA1_GOSHI (Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 PE=2 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 4.368e-57
Identity = 90/111 (81.08%), Postives = 97/111 (87.39%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P DVTK WPEDI+PLQPVGRLVLNKNIDNFFAENE LAF P IVVPGIYYS+DK+LQ RIF+Y DTQRHRLGPNYL LP NAPKC H NNH++GFMNFMHRDEE+   YFP
Sbjct:  286 PLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEI--NYFP 394          

HSP 2 Score: 47.7506 bits (112), Expect = 4.368e-57
Identity = 19/24 (79.17%), Postives = 22/24 (91.67%), Query Frame = 2
Query:   14 HPEWKLYIQTIDPDHEDQFVSDPL 85
            +PEWKL+IQTIDPDHED+F  DPL
Sbjct:  264 YPEWKLFIQTIDPDHEDKFDFDPL 287          
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA2_ORYSJ (Catalase isozyme B OS=Oryza sativa subsp. japonica GN=CATB PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 7.425e-57
Identity = 90/111 (81.08%), Postives = 98/111 (88.29%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P DVTK WPEDIIPLQPVGR+VLNKNIDNFFAENE LAF P I+VPGI+YS+DK+LQ RIF+Y DTQRHRLGPNYLMLPVNAPKC + NNH+DG MNFMHRDEEV   YFP
Sbjct:  286 PLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEV--NYFP 394          

HSP 2 Score: 49.2914 bits (116), Expect = 7.425e-57
Identity = 20/24 (83.33%), Postives = 22/24 (91.67%), Query Frame = 2
Query:   14 HPEWKLYIQTIDPDHEDQFVSDPL 85
            +PEWKLYIQTIDPDHED+F  DPL
Sbjct:  264 YPEWKLYIQTIDPDHEDRFDFDPL 287          
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA2_ORYSI (Catalase isozyme B OS=Oryza sativa subsp. indica GN=CATB PE=2 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 7.425e-57
Identity = 90/111 (81.08%), Postives = 98/111 (88.29%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P DVTK WPEDIIPLQPVGR+VLNKNIDNFFAENE LAF P I+VPGI+YS+DK+LQ RIF+Y DTQRHRLGPNYLMLPVNAPKC + NNH+DG MNFMHRDEEV   YFP
Sbjct:  286 PLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEV--NYFP 394          

HSP 2 Score: 49.2914 bits (116), Expect = 7.425e-57
Identity = 20/24 (83.33%), Postives = 22/24 (91.67%), Query Frame = 2
Query:   14 HPEWKLYIQTIDPDHEDQFVSDPL 85
            +PEWKLYIQTIDPDHED+F  DPL
Sbjct:  264 YPEWKLYIQTIDPDHEDRFDFDPL 287          
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA1_CUCPE (Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 2.145e-56
Identity = 88/111 (79.28%), Postives = 97/111 (87.39%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P DVTK WPEDI+PLQPVGR+VLNKNIDNFFAENE LAF P I+VPG+YYS+DK+LQ RIF+Y DTQRHRLGPNYL LP NAPKC H NNH++GFMNFMHRDEEV   YFP
Sbjct:  286 PLDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEV--NYFP 394          

HSP 2 Score: 46.595 bits (109), Expect = 2.145e-56
Identity = 18/24 (75.00%), Postives = 22/24 (91.67%), Query Frame = 2
Query:   14 HPEWKLYIQTIDPDHEDQFVSDPL 85
            +PEWKL+IQTIDPDHED++  DPL
Sbjct:  264 YPEWKLFIQTIDPDHEDKYDFDPL 287          
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA3_ARATH (Catalase-3 OS=Arabidopsis thaliana GN=CAT3 PE=1 SV=3)

HSP 1 Score: 199.519 bits (506), Expect = 2.796e-56
Identity = 90/111 (81.08%), Postives = 99/111 (89.19%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P DVTK WPEDI+PLQPVGRLVLN+ IDNFF E E LAFNPG+VVPGIYYS+DK+LQCRIFAYGDTQRHRLGPNYL LPVNAPKC H NNH++GFMNFMHRDEE+   Y+P
Sbjct:  286 PLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEI--NYYP 394          

HSP 2 Score: 40.817 bits (94), Expect = 2.796e-56
Identity = 17/27 (62.96%), Postives = 21/27 (77.78%), Query Frame = 2
Query:    5 SWKHPEWKLYIQTIDPDHEDQFVSDPL 85
            S  +PEWKL+IQT+DP  ED+F  DPL
Sbjct:  261 SGNYPEWKLFIQTMDPADEDKFDFDPL 287          
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA4_SOYBN (Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.645e-56
Identity = 90/111 (81.08%), Postives = 97/111 (87.39%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P DVTK WPEDIIPLQPVGRLVLNKNIDNFFAENE LAF P IVVPG+YYS+DKMLQ RIF+Y D+QRHRLGPNYL LP NAPKC H NNH++GFMNF+HRDEEV   YFP
Sbjct:  286 PLDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEV--NYFP 394          

HSP 2 Score: 45.8246 bits (107), Expect = 3.645e-56
Identity = 17/24 (70.83%), Postives = 22/24 (91.67%), Query Frame = 2
Query:   14 HPEWKLYIQTIDPDHEDQFVSDPL 85
            +PEWKL++QTIDP+HED+F  DPL
Sbjct:  264 YPEWKLFVQTIDPEHEDKFDFDPL 287          
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA1_MAIZE (Catalase isozyme 1 OS=Zea mays GN=CAT1 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.053e-55
Identity = 89/111 (80.18%), Postives = 97/111 (87.39%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P DVTK WPEDIIPLQPVGR+VLNKN+DNFFAENE +AF P I VP I+YS+DK+LQ RIF+Y DTQRHRLGPNYLMLPVNAPKC H NNH+DGFMNFMHRDEEV   YFP
Sbjct:  286 PLDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAISVPAIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEV--NYFP 394          

HSP 2 Score: 45.4394 bits (106), Expect = 1.053e-55
Identity = 19/24 (79.17%), Postives = 21/24 (87.50%), Query Frame = 2
Query:   14 HPEWKLYIQTIDPDHEDQFVSDPL 85
            +PEWKLYIQTID DHED+F  DPL
Sbjct:  264 YPEWKLYIQTIDLDHEDKFDFDPL 287          
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA_AVIMR (Catalase OS=Avicennia marina PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.373e-55
Identity = 92/111 (82.88%), Postives = 99/111 (89.19%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P D TK WPEDIIPL PVGR+VLNKNIDNFFAENEMLAF+P ++VPGI +SNDKMLQ RIFAYGDTQRHRLGPNYL+LPVNAPKC + NNHYDGFMNFMHRDEEV   YFP
Sbjct:  286 PLDTTKIWPEDIIPLIPVGRMVLNKNIDNFFAENEMLAFSPHMIVPGINFSNDKMLQTRIFAYGDTQRHRLGPNYLLLPVNAPKCAYHNNHYDGFMNFMHRDEEV--DYFP 394          

HSP 2 Score: 41.2022 bits (95), Expect = 1.373e-55
Identity = 16/24 (66.67%), Postives = 19/24 (79.17%), Query Frame = 2
Query:   14 HPEWKLYIQTIDPDHEDQFVSDPL 85
            +PEWKLY Q +DPD ED+F  DPL
Sbjct:  264 YPEWKLYFQIMDPDQEDRFDFDPL 287          
BLAST of FC868664 vs. ExPASy Swiss-Prot
Match: CATA1_RICCO (Catalase isozyme 1 OS=Ricinus communis GN=CAT1 PE=2 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 1.373e-55
Identity = 91/111 (81.98%), Postives = 97/111 (87.39%), Query Frame = 1
Query:   79 PTDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVLSFYFP 411
            P DVTK WPEDI+PLQPVGRLVLNKNIDNFFAENE LAF PGIVVPG+ YS DK+LQ RIF+Y DTQRHRLGPNYL LPVNAPKC H NNH++GFMNFMHRDEEV   YFP
Sbjct:  286 PLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEV--NYFP 394          

HSP 2 Score: 42.743 bits (99), Expect = 1.373e-55
Identity = 17/24 (70.83%), Postives = 20/24 (83.33%), Query Frame = 2
Query:   14 HPEWKLYIQTIDPDHEDQFVSDPL 85
            +PEWKLYIQ +DP HED+F  DPL
Sbjct:  264 YPEWKLYIQIMDPAHEDKFDFDPL 287          
The following BLAST results are available for this feature:
BLAST of FC868664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 141
Match NameE-valueIdentityDescription
CATA_HELAN4.368e-5781.98Catalase OS=Helianthus annuus PE=2 SV=1[more]
CATA1_GOSHI4.368e-5781.08Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 P... [more]
CATA2_ORYSJ7.425e-5781.08Catalase isozyme B OS=Oryza sativa subsp. japonica... [more]
CATA2_ORYSI7.425e-5781.08Catalase isozyme B OS=Oryza sativa subsp. indica G... [more]
CATA1_CUCPE2.145e-5679.28Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 ... [more]
CATA3_ARATH2.796e-5681.08Catalase-3 OS=Arabidopsis thaliana GN=CAT3 PE=1 SV... [more]
CATA4_SOYBN3.645e-5681.08Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1[more]
CATA1_MAIZE1.053e-5580.18Catalase isozyme 1 OS=Zea mays GN=CAT1 PE=2 SV=1[more]
CATA_AVIMR1.373e-5582.88Catalase OS=Avicennia marina PE=2 SV=1[more]
CATA1_RICCO1.373e-5581.98Catalase isozyme 1 OS=Ricinus communis GN=CAT1 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31003C03EF AbioticL1 Citrus clementina cDNA clone C31003C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868664 ID=FC868664|Name=FC868664|organism=Citrus clementina|type=EST|length=702bp
TTGCAGCTGGAAACATCCTGAGTGGAAACTCTACATTCAGACTATTGATC
CCGATCACGAGGACCAATTTGTCTCTGACCCACTGACGTAACCAAGTGGT
GGCCTGAGGACATCATCCCTCTGCAGCCAGTTGGACGCTTGGTCTTGAAC
AAGAACATCGATAATTTCTTTGCGGAAAATGAAATGCTTGCATTTAACCC
TGGTATCGTGGTTCCTGGGATCTACTACTCAAATGATAAGATGCTCCAAT
GTCGAATCTTTGCCTATGGTGATACCCAGAGGCATCGCCTTGGACCCAAC
TACTTGATGCTTCCAGTTAATGCACCCAAATGTCCTCATCGCAACAATCA
TTATGATGGTTTCATGAATTTCATGCACAGGGATGAGGAGGTACTTAGTT
TCTACTTTCCCCCCTGGAAACAAAATTTATGAATCAAAATAGGCTCGGCA
CCTATAATCTATCCACATTTATCTTAACTTAGATAATGGTGCATGTCTTA
AAGATACAAGTGCTTAGTACAAGTGGATGGTATCAGAATCTAACCTGTTG
TGTGCTAGTGTTATAAAAAAATGCTCTAATTGGATATTATGATGCTTTGT
TTTAGGTCGATTACTTTCCTTCGAGGTATGATCCTACTCGTCATGCTGAG
AGATATCCCATTCCTTCTGATGTAATTACAGGAAGGCGTGAGAAGGCTTG
CA
back to top