FC868670

Overview
NameFC868670
Unique NameFC868670
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC868670_ssr6 microsatellite FC868670_ssr6:6..15. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9463 contig Ccv1_Contig9463:76..762. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPE_SPIOL (Ribulose-phosphate 3-epimerase, chloroplastic OS=Spinacia oleracea GN=RPE PE=1 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 2.149e-96
Identity = 182/217 (83.87%), Postives = 196/217 (90.32%), Query Frame = 3
Query:   48 MSTGSLCSST--TQINGFTGGFMLQKT--NLNQPSSLSFTRGRIHTIVKASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            MS  SLC ST  +QINGF GG  ++K   + + P+SL+FTR ++ T+VKA++RVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCE +STIHLHRT+NQIK LGAKAGVVLNP T LS IE VLDVVDLVLIMSVNPGFGGQSFIESQVKKI
Sbjct:    1 MSAASLCQSTLQSQINGFCGGLNIRKLQPSTSSPNSLTFTRRKVQTLVKATSRVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCELASTIHLHRTVNQIKSLGAKAGVVLNPGTPLSTIEYVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 217          
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPE_SOLTU (Ribulose-phosphate 3-epimerase, chloroplastic (Fragment) OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 2.011e-94
Identity = 175/212 (82.55%), Postives = 190/212 (89.62%), Query Frame = 3
Query:   51 STGSLCSSTTQINGFTGGFMLQKTNLNQPSSLSFTRGRIHTIVKASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            S GS     +QI+GF G   LQK + + P+SL+FTR RI T+V AS+RVDKFSKSDIIVSPSILSANF+KLGEQVKA+E AGCDWIHVDVMDGRFVPNITIGPLVVD+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSSTIHLHRT+NQIK LGAKAGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVKKI
Sbjct:    1 SLGSSTLLQSQISGFGGSQKLQKISFSNPNSLTFTRRRIQTVVNASSRVDKFSKSDIIVSPSILSANFSKLGEQVKAIEQAGCDWIHVDVMDGRFVPNITIGPLVVDSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSSTIHLHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVKKI 212          
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPE_ORYSJ (Ribulose-phosphate 3-epimerase, chloroplastic OS=Oryza sativa subsp. japonica GN=RPE PE=1 SV=2)

HSP 1 Score: 317.005 bits (811), Expect = 5.865e-86
Identity = 162/181 (89.50%), Postives = 172/181 (95.03%), Query Frame = 3
Query:  144 LSFTRGRIHTIVKASARVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            L+F+  R    V+AS+RVDKFSK+DIIVSPSILSANF+KLGEQVKAVE+AGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRT+NQIK LGAKAGVVLNPAT L+AI+ VLDVVDLVLIMSVNPGFGGQSFIESQVKKI
Sbjct:   26 LAFSSPRKAFRVRASSRVDKFSKNDIIVSPSILSANFSKLGEQVKAVEVAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTVNQIKSLGAKAGVVLNPATPLTAIDYVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 206          
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPE_SYNY3 (Ribulose-phosphate 3-epimerase OS=Synechocystis sp. (strain PCC 6803) GN=rpe PE=1 SV=3)

HSP 1 Score: 224.557 bits (571), Expect = 3.962e-58
Identity = 110/157 (70.06%), Postives = 133/157 (84.71%), Query Frame = 3
Query:  216 DIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            +I+V+PSILSA+F++LGE++KAV+ AG DWIHVDVMDGRFVPNITIGPL+VDA+RP+T   LDVHLMIVEPE+ V DF KAGADI+SVH E +++ HLHRTL QI++LG KAG VLNP+T L  +E VL V DL+LIMSVNPGFGGQSFI   + KI
Sbjct:    4 NIVVAPSILSADFSRLGEEIKAVDEAGADWIHVDVMDGRFVPNITIGPLIVDAIRPLTKKTLDVHLMIVEPEKYVEDFAKAGADIISVHVEHNASPHLHRTLCQIRELGKKAGAVLNPSTPLDFLEYVLPVCDLILIMSVNPGFGGQSFIPEVLPKI 160          
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPE_BACSU (Ribulose-phosphate 3-epimerase OS=Bacillus subtilis GN=rpe PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.612e-51
Identity = 103/156 (66.03%), Postives = 123/156 (78.85%), Query Frame = 3
Query:  219 IIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            I V+PSILSA+FA LG ++K VE  G D IH+DVMDG FVPNITIGPL+V+A+RPVTDLPLDVHLMI EP++ +P F KAGADI+SVH E  +  HLHRT+  IK+ G KAGVVLNP T +  IE V D +DLVL+M+VNPGFGGQ FI S + KI
Sbjct:    2 IKVAPSILSADFAALGNEIKDVEKGGADCIHIDVMDGHFVPNITIGPLIVEAVRPVTDLPLDVHLMIEEPDRYIPAFAKAGADILSVHAE--ACPHLHRTIQLIKEQGVKAGVVLNPHTPVQVIEHVFDDLDLVLLMTVNPGFGGQKFIHSVLPKI 155          
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPEC_RALEH (Ribulose-phosphate 3-epimerase, chromosomal OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEC PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.600e-43
Identity = 87/160 (54.37%), Postives = 118/160 (73.75%), Query Frame = 3
Query:  207 SKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            S+  I ++PSILSA+FA+LGE+V A+E  G D +H DVMD  +VPN+TIGPLV +A+RP+  +P+DVHLM+   +  +P F KAGA+I+S H E S   H+ RT+  I+D G KAG+VLNPAT L  ++  LD +DLVL+MSVNPGFGGQ+FI   + K+
Sbjct:   12 SQRAIRLAPSILSADFARLGEEVCAIEAGGADLVHFDVMDNHYVPNLTIGPLVCEAIRPLVSIPIDVHLMVEPVDALIPLFAKAGANIISFHPEASR--HVDRTIGLIRDHGCKAGLVLNPATPLGWLDHTLDQLDLVLLMSVNPGFGGQAFIPGVLDKV 169          
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPEP_RALEH (Ribulose-phosphate 3-epimerase, plasmid OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEP PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.368e-42
Identity = 86/160 (53.75%), Postives = 118/160 (73.75%), Query Frame = 3
Query:  207 SKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            S+  I ++PSILSA+FA+LGE+V A+E  G D +H DVMD  +V N+TIGPLV +A+RP+  +P+DVHLM+   +  +P F KAGA+++S H E S   H+ RT+  I+D G KAG+VLNPAT LS ++  LD +DLVL+MSVNPGFGGQ+FI   + K+
Sbjct:   12 SQRAIRLAPSILSADFARLGEEVCAIEAGGADLVHFDVMDNHYVSNLTIGPLVCEAIRPLVSIPIDVHLMVEPVDALIPMFAKAGANLISFHPEASR--HVDRTIGLIRDHGCKAGLVLNPATPLSWLDHTLDKLDLVLLMSVNPGFGGQAFIPGVLDKV 169          
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPE_AQUAE (Ribulose-phosphate 3-epimerase OS=Aquifex aeolicus GN=rpe PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 8.299e-40
Identity = 81/155 (52.26%), Postives = 111/155 (71.61%), Query Frame = 3
Query:  222 IVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            +++PSIL+ ++  +GEQ++A    G D +H DVMDG FVPNIT G  ++  +R    LP+D HLMI  P++ +P F++AGA+ +SVH E  +  H+HRTL  IK+LGAKAGVV+NP TSLSAIE  L   D VL+MSVNPGF GQ FIE  ++++
Sbjct:    3 LLAPSILAGDWWCIGEQIQATIRGGADILHYDVMDGHFVPNITAGYEILSHIRKRASLPIDAHLMIENPDKYIPKFVEAGANWISVHIE--NNYHIHRTLQLIKELGAKAGVVVNPGTSLSAIEEALYYADYVLLMSVNPGFSGQKFIERSIERL 155          
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPE_BUCAP (Ribulose-phosphate 3-epimerase OS=Buchnera aphidicola subsp. Schizaphis graminum GN=rpe PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.416e-39
Identity = 80/155 (51.61%), Postives = 112/155 (72.26%), Query Frame = 3
Query:  225 VSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVT-DLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            ++ SILSA+FA+LGE  K    AG DWIH DVMD  +VPN+T+GP+++ ALR     +P+DVHLM+   +  +P F +AGAD ++ H E  ST H+ RTLN IK+ G KAG+ LNPATSL+ ++ V++ +DL+L+MSVNPGFG QSF+ +   K+
Sbjct:    6 LASSILSADFARLGEDTKKAIDAGSDWIHFDVMDNHYVPNLTMGPMILKALRNYNITVPIDVHLMVKPVDNLIPQFAEAGADFITFHPE--STDHIDRTLNLIKECGCKAGLALNPATSLNFLDYVMEKLDLILLMSVNPGFGNQSFLPTSFNKL 158          
BLAST of FC868670 vs. ExPASy Swiss-Prot
Match: RPE_SERMA (Ribulose-phosphate 3-epimerase OS=Serratia marcescens GN=rpe PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.849e-39
Identity = 83/156 (53.21%), Postives = 111/156 (71.15%), Query Frame = 3
Query:  222 IVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPV-TDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKI 686
            +++PSILSA+FA+LGE    V  AG D +H DVMD  +VPN+TIGP+V +ALR      P+DVHLM+   ++ VPDF KAGA  +S H E S   H+ RT+  IK+ G KAG+V NPAT LS ++ V+D +D++L+MSVNPGFGGQSFI   + K+
Sbjct:    5 LIAPSILSADFARLGEDTANVLAAGGDVVHFDVMDNHYVPNLTIGPMVCEALRNYGITAPIDVHLMVKPVDRIVPDFAKAGASYISFHPEASE--HVDRTIQLIKEHGCKAGLVFNPATPLSYLDYVMDKIDVILLMSVNPGFGGQSFIHGTLDKL 158          
The following BLAST results are available for this feature:
BLAST of FC868670 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
RPE_SPIOL2.149e-9683.87Ribulose-phosphate 3-epimerase, chloroplastic OS=S... [more]
RPE_SOLTU2.011e-9482.55Ribulose-phosphate 3-epimerase, chloroplastic (Fra... [more]
RPE_ORYSJ5.865e-8689.50Ribulose-phosphate 3-epimerase, chloroplastic OS=O... [more]
RPE_SYNY33.962e-5870.06Ribulose-phosphate 3-epimerase OS=Synechocystis sp... [more]
RPE_BACSU1.612e-5166.03Ribulose-phosphate 3-epimerase OS=Bacillus subtili... [more]
RPEC_RALEH3.600e-4354.38Ribulose-phosphate 3-epimerase, chromosomal OS=Ral... [more]
RPEP_RALEH1.368e-4253.75Ribulose-phosphate 3-epimerase, plasmid OS=Ralston... [more]
RPE_AQUAE8.299e-4052.26Ribulose-phosphate 3-epimerase OS=Aquifex aeolicus... [more]
RPE_BUCAP1.416e-3951.61Ribulose-phosphate 3-epimerase OS=Buchnera aphidic... [more]
RPE_SERMA1.849e-3953.21Ribulose-phosphate 3-epimerase OS=Serratia marcesc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31003C09EF AbioticL1 Citrus clementina cDNA clone C31003C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868670 ID=FC868670|Name=FC868670|organism=Citrus clementina|type=EST|length=687bp
GGGGAAGAGAGAGAGTTTGAAGATCGTGAAACAAAAAAAGCGTCAAGATG
TCTACAGGCTCGCTGTGTTCATCAACGACTCAGATCAATGGCTTTACAGG
TGGTTTCATGTTGCAGAAAACCAATCTTAATCAGCCCAGTTCACTTAGTT
TTACAAGGGGGAGAATTCATACTATAGTGAAGGCATCAGCTCGTGTGGAT
AAGTTCTCGAAAAGTGATATTATTGTTTCTCCATCTATTCTCTCTGCTAA
TTTCGCGAAGTTAGGCGAGCAGGTAAAAGCAGTGGAATTGGCTGGTTGTG
ATTGGATTCATGTTGATGTCATGGATGGTCGTTTTGTTCCAAACATTACA
ATTGGACCTCTTGTGGTTGATGCCTTGCGCCCTGTGACAGACCTTCCTTT
GGATGTTCATTTGATGATTGTCGAACCTGAACAACGAGTGCCTGATTTTA
TCAAGGCTGGAGCAGACATAGTCAGCGTCCACTGTGAGCAATCATCCACC
ATTCATTTGCACCGCACTCTTAACCAAATAAAAGATTTGGGAGCTAAAGC
TGGAGTTGTCCTTAACCCTGCTACCTCACTGAGTGCAATAGAATGTGTCC
TTGATGTGGTTGATCTTGTCTTGATCATGTCGGTGAACCCTGGCTTTGGT
GGGCAAAGCTTTATTGAGAGCCAAGTAAAAAAAATCT
back to top