FC868752

Overview
NameFC868752
Unique NameFC868752
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9385 contig Ccv1_Contig9385:1..725. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: TOR_DROME (Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.066e-80
Identity = 139/188 (73.94%), Postives = 168/188 (89.36%), Query Frame = 3
Query:    3 LIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFNE 566
            LIR+YRD +K+ LNQEH+ ML+FAPDYDHL L+ KVEVFE+AL  T+G+DLA++LWLKS +SE+W ERR NYTRSLAVMSMVGY+LGLGDRHPSNLML R SGKILHIDFGDCFE +M REKFPEK+PFRLTRML+KAMEV+GIEG +R TCE+VM VLR N+DS+MA++EAFV+DPL+NWRL + ++
Sbjct: 2170 LIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDDLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLEAFVYDPLLNWRLLDVDK 2357          
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: TOR2_SCHPO (Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe GN=tor2 PE=1 SV=2)

HSP 1 Score: 293.893 bits (751), Expect = 5.848e-79
Identity = 145/227 (63.88%), Postives = 175/227 (77.09%), Query Frame = 3
Query:    3 LIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFNEVPQMSVFANTHVPPVVNAEETAPNRELPQPQRGAREREL 683
            LIR+YR++RKI LN EH+ ++  APDYD L L+ KVEVFEYAL +T G DL RVLWLKSR+SE WL RRTNY+R+LAVMSMVGY+LGLGDRHPSNLML RY+G I+HIDFGDCFE +M+REKFPEK+PFRLTRMLV AMEVSGIEG FR TCE+VM+VLR+N++SVMA++EAFV+DPLINWRL            A  + P +   +   PN  L +   G   + L
Sbjct: 2051 LIRDYRESRKILLNIEHRLIIQMAPDYDRLTLLQKVEVFEYALLSTTGQDLYRVLWLKSRSSEAWLNRRTNYSRTLAVMSMVGYILGLGDRHPSNLMLDRYTGNIIHIDFGDCFEVAMHREKFPEKIPFRLTRMLVNAMEVSGIEGTFRITCEHVMRVLRTNKESVMAVLEAFVYDPLINWRL------------APAYSPSIDEKQSNEPNTLLGETIDGLHRKRL 2265          
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: FRAP_RAT (Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Frap1 PE=1 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.303e-78
Identity = 135/187 (72.19%), Postives = 164/187 (87.70%), Query Frame = 3
Query:    3 LIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFN 563
            LIR+YR+ +KI LN EH+ ML  APDYDHL L+ KVEVFE+A+ NT G+DLA++LWLKS +SE+W +RRTNYTRSLAVMSMVGY+LGLGDRHPSNLML R SGKILHIDFGDCFE +M REKFPEK+PFRLTRML  AMEV+G++GN+R+TC  VM+VLR ++DSVMA++EAFV+DPL+NWRL + N
Sbjct: 2249 LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTN 2435          
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: FRAP_MOUSE (Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Frap1 PE=1 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.303e-78
Identity = 135/187 (72.19%), Postives = 164/187 (87.70%), Query Frame = 3
Query:    3 LIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFN 563
            LIR+YR+ +KI LN EH+ ML  APDYDHL L+ KVEVFE+A+ NT G+DLA++LWLKS +SE+W +RRTNYTRSLAVMSMVGY+LGLGDRHPSNLML R SGKILHIDFGDCFE +M REKFPEK+PFRLTRML  AMEV+G++GN+R+TC  VM+VLR ++DSVMA++EAFV+DPL+NWRL + N
Sbjct: 2249 LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTN 2435          
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: FRAP_HUMAN (Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=FRAP1 PE=1 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 2.902e-78
Identity = 135/187 (72.19%), Postives = 163/187 (87.17%), Query Frame = 3
Query:    3 LIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFN 563
            LIR+YR+ +KI LN EH+ ML  APDYDHL L+ KVEVFE+A+ NT G+DLA++LWLKS +SE+W +RRTNYTRSLAVMSMVGY+LGLGDRHPSNLML R SGKILHIDFGDCFE +M REKFPEK+PFRLTRML  AMEV+G++GN+R TC  VM+VLR ++DSVMA++EAFV+DPL+NWRL + N
Sbjct: 2249 LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTN 2435          
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: TOR2_YEAST (Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae GN=TOR2 PE=1 SV=3)

HSP 1 Score: 290.041 bits (741), Expect = 8.444e-78
Identity = 148/232 (63.79%), Postives = 176/232 (75.86%), Query Frame = 3
Query:    3 LIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFNEVPQMSVFANTHVP-PVVNAEETAPNRELPQPQRGARERELLQAV 695
            LIRE+R+A+KI LN EH  ML  APDYD+L L+ KVEVF YAL NTEG DL +VLWLKSR+SE WLERRT YTRSLAVMSM GY+LGLGDRHPSNLML R +GK++HIDFGDCFEA++ REKFPEKVPFRLTRML  AMEVSGIEG+FR TCENVM+VLR N+ S+MA++EAF  DPLINW      ++P   +   T +  PV+NA E   N  + + +    E E   A+
Sbjct: 2190 LIREHREAKKIPLNIEHWVMLQMAPDYDNLTLLQKVEVFTYALNNTEGQDLYKVLWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKFPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMKVLRDNKGSLMAILEAFAFDPLINWGF----DLPTKKIEEETGIQLPVMNANELLSNGAITEEEVQRVENEHKNAI 2417          
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: TOR_DICDI (Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.103e-77
Identity = 135/188 (71.81%), Postives = 164/188 (87.23%), Query Frame = 3
Query:    3 LIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFNE 566
            LI+++RD+ KI L+ EH+ ML    DYD+L L+ KVEVF+YAL+N+ G DL +VLWLKSR SE+WL+RRTNYTRSLAVMSMVGY+LGLGDRHPSNLML R++G ILHIDFGDCFE +M+R+K+PEK+PFRLTRML+ AMEVSGIEGNFR TCE VM VLR+N++S+MA++EAFVHDPLINWRL   NE
Sbjct: 2057 LIKDFRDSNKILLSIEHRLMLQMCSDYDNLTLLQKVEVFQYALENSNGLDLHKVLWLKSRNSEVWLDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRHTGHILHIDFGDCFEVAMHRDKYPEKIPFRLTRMLINAMEVSGIEGNFRLTCEAVMNVLRNNKESLMAVLEAFVHDPLINWRLLTPNE 2244          
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: TOR1_YEAST (Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae GN=TOR1 PE=1 SV=3)

HSP 1 Score: 283.108 bits (723), Expect = 1.032e-75
Identity = 138/209 (66.03%), Postives = 169/209 (80.86%), Query Frame = 3
Query:    3 LIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFNEVPQMSVFANTHVP-PVVNAEE 626
            LIRE+RDA+KI LN EH  ML  APDY++L L+ K+EVF YAL NT+G DL ++LWLKSR+SE WLERRT YTRSLAVMSM GY+LGLGDRHPSNLML R +GK++HIDFGDCFEA++ REK+PEKVPFRLTRML  AMEVSGIEG+FR TCENVM+VLR N++S+MA++EAF  DPLI+W      ++P   +   T +P P++N  E
Sbjct: 2186 LIREHRDAKKIPLNIEHWVMLQMAPDYENLTLLQKIEVFTYALDNTKGQDLYKILWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMRVLRDNKESLMAILEAFALDPLIHWGF----DLPPQKLTEQTGIPLPLINPSE 2390          
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: TOR1_SCHPO (Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe GN=tor1 PE=1 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 8.738e-75
Identity = 136/208 (65.38%), Postives = 169/208 (81.25%), Query Frame = 3
Query:    3 LIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFNEVPQMSVFANTHVPPVVNAEE 626
            LI+E+R  R I LN EH+ ML  APD D L L+ K+EVFEY + NT+G DL  VLWLKSR+SE WL+RRT+YT+SLAVMSMVGY+LGLGDRHPSNLM+ RYSGKI+HIDFGDCFE +M+REKFPEK+PFRLTRML+ AMEVSGI+G ++ TCE VM+VLRSN +S+MA++EAFV+DPLINWRL     + + S  A+T + P  ++ E
Sbjct: 2048 LIKEFRSKRNILLNLEHRMMLQMAPDCDSLTLLQKLEVFEYVMANTDGYDLYHVLWLKSRSSEAWLDRRTSYTQSLAVMSMVGYILGLGDRHPSNLMMDRYSGKIIHIDFGDCFEVAMHREKFPEKIPFRLTRMLINAMEVSGIQGTYKITCELVMRVLRSNTESLMAVLEAFVYDPLINWRL-----MTKSSFGASTTLRPTSSSVE 2250          
BLAST of FC868752 vs. ExPASy Swiss-Prot
Match: TOR_CAEEL (Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3)

HSP 1 Score: 242.276 bits (617), Expect = 2.019e-63
Identity = 112/184 (60.87%), Postives = 153/184 (83.15%), Query Frame = 3
Query:    3 LIREYRDAR-KITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRL 551
            L++EYR+ + KI L+ EHK +   + + +HL L+ K+++FE AL  T+G DL  VLWLKS +SE+W +RRTNYTRS+A MSMVGY+LGLGDRHPSNLML R +GK++HIDFGDCFE +M REKFPE+VPFRLTRML+ AMEV+G++G +  T E V+++LR+N++S++A++EAFV+DP+INWRL
Sbjct: 2425 LVKEYREKKAKIPLSIEHKTLQKLSLETEHLTLMQKLQLFESALSVTQGEDLRHVLWLKSPSSEVWFDRRTNYTRSVACMSMVGYILGLGDRHPSNLMLDRLTGKVVHIDFGDCFEVAMLREKFPERVPFRLTRMLINAMEVTGLDGVYNYTAERVLKMLRTNQESLLAVLEAFVYDPVINWRL 2608          
The following BLAST results are available for this feature:
BLAST of FC868752 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 57
Match NameE-valueIdentityDescription
TOR_DROME1.066e-8073.94Target of rapamycin OS=Drosophila melanogaster GN=... [more]
TOR2_SCHPO5.848e-7963.88Phosphatidylinositol 3-kinase tor2 OS=Schizosaccha... [more]
FRAP_RAT1.303e-7872.19Serine/threonine-protein kinase mTOR OS=Rattus nor... [more]
FRAP_MOUSE1.303e-7872.19Serine/threonine-protein kinase mTOR OS=Mus muscul... [more]
FRAP_HUMAN2.902e-7872.19Serine/threonine-protein kinase mTOR OS=Homo sapie... [more]
TOR2_YEAST8.444e-7863.79Serine/threonine-protein kinase TOR2 OS=Saccharomy... [more]
TOR_DICDI1.103e-7771.81Target of rapamycin OS=Dictyostelium discoideum GN... [more]
TOR1_YEAST1.032e-7566.03Serine/threonine-protein kinase TOR1 OS=Saccharomy... [more]
TOR1_SCHPO8.738e-7565.38Phosphatidylinositol 3-kinase tor1 OS=Schizosaccha... [more]
TOR_CAEEL2.019e-6360.87Target of rapamycin homolog OS=Caenorhabditis eleg... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004D02EF AbioticL1 Citrus clementina cDNA clone C31004D02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868752 ID=FC868752|Name=FC868752|organism=Citrus clementina|type=EST|length=725bp
ATCTTATTCGGGAATATAGGGATGCCCGAAAGATCACCTTAAACCAAGAG
CATAAATATATGCTAAGTTTTGCACCAGATTATGACCATTTGCCTCTCAT
AGCCAAAGTGGAAGTTTTTGAATATGCTCTACAAAATACTGAAGGGAATG
ATCTGGCCAGGGTGCTTTGGTTAAAAAGCCGTACTTCTGAAATATGGCTA
GAGAGGAGGACGAACTATACCAGAAGTTTAGCAGTGATGAGCATGGTTGG
ATACCTTCTTGGTTTAGGGGATCGGCACCCAAGTAATCTTATGCTGCACC
GCTATAGTGGGAAAATTTTACACATAGATTTTGGGGACTGCTTTGAAGCT
TCAATGAACCGGGAGAAGTTCCCTGAAAAGGTTCCTTTTCGCTTGACTAG
AATGCTTGTTAAAGCTATGGAGGTTAGTGGTATTGAGGGCAACTTCCGTT
CAACATGCGAAAATGTGATGCAAGTTCTGCGCTCAAATAGGGATAGTGTT
ATGGCTATGATGGAGGCCTTTGTTCATGATCCTCTCATCAATTGGCGTCT
TTTCAATTTTAATGAAGTACCGCAAATGTCAGTGTTTGCAAATACTCATG
TCCCTCCTGTTGTGAATGCCGAAGAAACTGCTCCAAATAGAGAACTTCCT
CAACCACAACGGGGTGCTCGTGAAAGGGAGCTTCTTCAGGCTGTTAATCA
ACTTGGTGATGCTAGTGAGGTTTTG
back to top