FC868797

Overview
NameFC868797
Unique NameFC868797
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length697
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYM_SOLTU (Serine hydroxymethyltransferase, mitochondrial OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 2.532e-108
Identity = 187/201 (93.03%), Postives = 195/201 (97.01%), Query Frame = 1
Query:   94 DKPTRPLFNGSSLYYMSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ 696
            DKP + L+NG SLYYMSSLPNEAVY+KEK+GV WPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDP KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct:   15 DKPVKSLYNGGSLYYMSSLPNEAVYDKEKSGVAWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ 215          
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYM_FLAPR (Serine hydroxymethyltransferase 1, mitochondrial OS=Flaveria pringlei PE=2 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 2.897e-104
Identity = 184/201 (91.54%), Postives = 190/201 (94.53%), Query Frame = 1
Query:   94 DKPTRPLFNGSSLYYMSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ 696
            DKP + LFNG  LY MSSLP+EAVYEKE+ GVTWPKQLNAPLEVVDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDP KWGVNVQ LSGSP+NF VYTALLK HDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct:   15 DKPLQRLFNGGHLYSMSSLPSEAVYEKERPGVTWPKQLNAPLEVVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKAHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ 215          
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYM_PEA (Serine hydroxymethyltransferase, mitochondrial OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 6.455e-104
Identity = 182/201 (90.55%), Postives = 192/201 (95.52%), Query Frame = 1
Query:   94 DKPTRPLFNGSSLYYMSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ 696
            +K +RPLF+ SSLYY SSLP+EAVY+KE   VTWPKQLN+PLEV+DPEIADIIE EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDP KWGVNVQ LSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct:   15 NKSSRPLFSASSLYYKSSLPDEAVYDKENPRVTWPKQLNSPLEVIDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ 215          
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYM_ARATH (Serine hydroxymethyltransferase, mitochondrial OS=Arabidopsis thaliana GN=SHM1 PE=1 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.076e-102
Identity = 182/201 (90.55%), Postives = 190/201 (94.53%), Query Frame = 1
Query:   94 DKPTRPLFNGSSLYYMSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ 696
            DKP RPL   +S Y MSSLP+EAV EKE++ VTWPKQLNAPLE VDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPEKWGVNVQ LSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct:   15 DKPIRPLIRSTSCY-MSSLPSEAVDEKERSRVTWPKQLNAPLEEVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ 214          
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYN_FLAPR (Serine hydroxymethyltransferase 2, mitochondrial OS=Flaveria pringlei PE=2 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 8.724e-101
Identity = 180/201 (89.55%), Postives = 187/201 (93.03%), Query Frame = 1
Query:   94 DKPTRPLFNGSSLYYMSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ 696
            +KP + LFNG  LY MSSLP+EAVYEKE+ GVTWPKQLNAPLEV DPEIADIIE EKARQWKGLELI SENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLD  KWGVNVQ LSGSP+NF VYTALLK HDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct:   15 NKPLQRLFNGGHLYSMSSLPSEAVYEKERPGVTWPKQLNAPLEVGDPEIADIIELEKARQWKGLELILSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDAAKWGVNVQPLSGSPANFHVYTALLKAHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ 215          
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYD_SCHPO (Probable serine hydroxymethyltransferase, cytosolic OS=Schizosaccharomyces pombe GN=SPAC24C9.12c PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.043e-61
Identity = 111/160 (69.38%), Postives = 132/160 (82.50%), Query Frame = 1
Query:  214 PLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYD 693
            PL+  DP +A+I+ HE  RQ   + LI SENFTS +VM A+GSVM+NKYSEGYPGARYYGGN++ID  E+LCQ+RAL AF LDP KWGVNVQ LSGSP+N QVY A++ PH R+M LDLP GGHLSHGYQTDTKKISAVS +FE+MPYR++ +TG IDYD
Sbjct:   11 PLKEQDPTVAEIMRHEADRQRSSVVLIASENFTSRAVMDALGSVMSNKYSEGYPGARYYGGNKFIDQIETLCQERALAAFNLDPAKWGVNVQCLSGSPANMQVYQAIMPPHGRLMGLDLPSGGHLSHGYQTDTKKISAVSTYFESMPYRVDPNTGLIDYD 170          
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYC_SCHPO (Probable serine hydroxymethyltransferase, cytosolic OS=Schizosaccharomyces pombe GN=shm2 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.322e-61
Identity = 112/165 (67.88%), Postives = 129/165 (78.18%), Query Frame = 1
Query:  199 KQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYD 693
            K L APL   DP +  I+E EK+RQ + + LI SENFTS +VM A+GS+M NKYSEGYPGARYYGGNE+ID AE LCQ RALEAF LD EKWGVNVQ  SGSP+N Q Y A++KPHDR+M LDLPHGGHLSHG+ T  K ISAVS +F TMPY +N+ TG IDYD
Sbjct:   12 KLLKAPLAECDPTVYKILESEKSRQKESIALIASENFTSRAVMDALGSIMQNKYSEGYPGARYYGGNEFIDQAERLCQTRALEAFHLDGEKWGVNVQPHSGSPANLQAYQAVMKPHDRLMGLDLPHGGHLSHGFSTPQKAISAVSTYFSTMPYNVNKETGIIDYD 176          
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYC1_DICDI (Serine hydroxymethyltransferase 1 OS=Dictyostelium discoideum GN=shmt1 PE=1 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 8.825e-61
Identity = 113/163 (69.33%), Postives = 134/163 (82.21%), Query Frame = 1
Query:  208 NAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ 696
            N PL+ VD EI +++  EK RQ+KGLELI SENFTS +VM+A+GS  TNKY+EGYPG+RYYGG E +D  E+LCQKRAL+AFRLD  KWGVNVQ  SGSP+NF VYTALL+PHDRIM LDLP GGHL+HGYQTD KKISA SIFFE+MPY++  + G IDY +
Sbjct:    7 NTPLKEVDNEIFELMNREKDRQFKGLELIASENFTSRAVMEALGSHFTNKYAEGYPGSRYYGGTEVVDELETLCQKRALKAFRLDESKWGVNVQPYSGSPANFAVYTALLRPHDRIMGLDLPSGGHLTHGYQTDKKKISASSIFFESMPYQIG-ADGLIDYQR 168          
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYM_CANAL (Serine hydroxymethyltransferase, mitochondrial OS=Candida albicans GN=SHM1 PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.966e-60
Identity = 110/163 (67.48%), Postives = 130/163 (79.75%), Query Frame = 1
Query:  205 LNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYD 693
            ++  ++ VDPE+ADI+  E+ RQ   + LIPSENFTS +VM  +GS M NKYSEGYPG RYYGGNE ID AE+LCQKRALEAF LDP +WGVNVQ LSG+P+N   Y+A+L+  DRIM LDLPHGGHLSHGYQT T KIS +S +F+TMPYRLNE TG IDYD
Sbjct:   35 ISKSVQDVDPEMADILNQERTRQKNSITLIPSENFTSKAVMDLLGSEMQNKYSEGYPGERYYGGNEIIDKAEALCQKRALEAFGLDPSQWGVNVQPLSGAPANLYAYSAILEVGDRIMGLDLPHGGHLSHGYQTKTTKISYISKYFQTMPYRLNEETGIIDYD 197          
BLAST of FC868797 vs. ExPASy Swiss-Prot
Match: GLYC_HUMAN (Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens GN=SHMT1 PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 9.758e-60
Identity = 109/166 (65.66%), Postives = 133/166 (80.12%), Query Frame = 1
Query:  199 KQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ 696
            K L  PL+  D E+ +II+ E  RQ  GLELI SENF S +V++A+GS + NKYSEGYPG RYYGG E+ID  E+LCQKRAL+A++LDP+ WGVNVQ  SGSP+NF VYTAL++PH RIM LDLP GGHL+HG+ TD KKISA SIFFE+MPY++N  TGYI+YDQ
Sbjct:   20 KMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQ 185          
The following BLAST results are available for this feature:
BLAST of FC868797 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GLYM_SOLTU2.532e-10893.03Serine hydroxymethyltransferase, mitochondrial OS=... [more]
GLYM_FLAPR2.897e-10491.54Serine hydroxymethyltransferase 1, mitochondrial O... [more]
GLYM_PEA6.455e-10490.55Serine hydroxymethyltransferase, mitochondrial OS=... [more]
GLYM_ARATH2.076e-10290.55Serine hydroxymethyltransferase, mitochondrial OS=... [more]
GLYN_FLAPR8.724e-10189.55Serine hydroxymethyltransferase 2, mitochondrial O... [more]
GLYD_SCHPO1.043e-6169.38Probable serine hydroxymethyltransferase, cytosoli... [more]
GLYC_SCHPO2.322e-6167.88Probable serine hydroxymethyltransferase, cytosoli... [more]
GLYC1_DICDI8.825e-6169.33Serine hydroxymethyltransferase 1 OS=Dictyostelium... [more]
GLYM_CANAL1.966e-6067.48Serine hydroxymethyltransferase, mitochondrial OS=... [more]
GLYC_HUMAN9.758e-6065.66Serine hydroxymethyltransferase, cytosolic OS=Homo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004H06EF AbioticL1 Citrus clementina cDNA clone C31004H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868797 ID=FC868797|Name=FC868797|organism=Citrus clementina|type=EST|length=697bp
AACAAAGAAGAAACAGAACAACATCTTGCAGCGGGAGAGTGAGAAGCAAA
AATGGCCATGGCTCTGGCTCTTCGCAGGCTCTCATCTTCCCTCGACAAAC
CCACTCGTCCTCTCTTCAATGGCTCCTCCCTCTACTACATGTCATCTTTG
CCAAATGAAGCTGTTTACGAGAAAGAGAAAAATGGTGTCACTTGGCCAAA
ACAACTGAATGCTCCACTTGAGGTCGTTGATCCTGAGATTGCTGACATTA
TCGAGCATGAAAAAGCACGACAATGGAAGGGACTTGAACTCATTCCTTCA
GAGAACTTTACTTCAGTATCCGTGATGCAAGCTGTGGGGTCTGTCATGAC
CAACAAGTACAGTGAAGGATATCCAGGTGCAAGATATTATGGAGGAAACG
AGTATATTGACATGGCGGAATCCTTATGTCAGAAGCGAGCTCTGGAAGCA
TTTCGGTTGGATCCTGAAAAATGGGGAGTGAATGTGCAGTCTCTGTCTGG
ATCTCCATCTAATTTTCAAGTCTACACTGCATTGTTAAAACCTCATGATA
GGATCATGGCACTTGATCTTCCTCATGGTGGGCATCTCTCACACGGCTAT
CAGACAGATACCAAAAAGATATCTGCAGTGTCCATATTTTTTGAGACAAT
GCCATACAGATTGAATGAGAGCACTGGCTATATAGACTATGACCAGT
back to top