FC868805

Overview
NameFC868805
Unique NameFC868805
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length656
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15457 contig Ccv1_Contig15457:708..1363. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: PAPSS_URECA (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 3.183e-86
Identity = 147/204 (72.06%), Postives = 177/204 (86.76%), Query Frame = 2
Query:   20 NWLIGGDLEVLEPIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFKVAAYDKTQGKMAFFDP 631
            +WL+GGDLEVLE I ++DGLD +RL+P +LR +F   NADAVFAFQLRNPVHNGHALLMTDTRRRL E GY+ P+LLLHPLGG+TK DDVPL+WRMKQH+ +L++ VLDP+ TV++IFPSPM YAGPTEVQWHAKAR++ GANFYIVGRDPAGM HP  K+DLY+A HG KVL+MAPGL +L I+PF+VAAY+KT+  M F+DP
Sbjct:  359 DWLVGGDLEVLERITWNDGLDEYRLTPNELRAKFRALNADAVFAFQLRNPVHNGHALLMTDTRRRLTERGYKKPVLLLHPLGGWTKDDDVPLAWRMKQHQAILDEKVLDPDYTVMAIFPSPMMYAGPTEVQWHAKARMSTGANFYIVGRDPAGMPHPETKQDLYNATHGAKVLTMAPGLTQLEIVPFRVAAYNKTKSAMDFYDP 562          
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: PAPS2_HUMAN (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 7.839e-85
Identity = 143/205 (69.76%), Postives = 177/205 (86.34%), Query Frame = 2
Query:   20 NWLIGGDLEVLEPIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFKVAAYDKTQGKMAFFDPS 634
            +WL+GGDL+VLE I+++DGLD++RL+P +L+ +  + NADAVFAFQLRNPVHNGHALLM DTRRRLLE GY++P+LLLHPLGG+TK DDVPL WRMKQH  VLE+GVLDP++T+V+IFPSPM YAGPTEVQWH ++R+ AGANFYIVGRDPAGM HP  K+DLY+  HG KVLSMAPGL  + I+PF+VAAY+K +  M F+DP+
Sbjct:  364 DWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGPTEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPA 568          
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: PAPS2_MOUSE (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus GN=Papss2 PE=1 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 4.302e-83
Identity = 142/205 (69.27%), Postives = 173/205 (84.39%), Query Frame = 2
Query:   20 NWLIGGDLEVLEPIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFKVAAYDKTQGKMAFFDPS 634
            +WL+GGDL+VLE I++ DGLD++RL+P +L+ +    NADAVFAFQLRNPVHNGHALLM DTRRRLLE GY++P+LLLHPLGG+TK DDVPL WRMKQH  VLE+ VLDP++T+V+IFPSPM YAGPTEVQWH + R+ AGANFYIVGRDPAGM HP  K+DLY+  HG KVLSMAPGL  + I+PF+VAAY+K +  M F+DP+
Sbjct:  370 DWLVGGDLQVLERIRWDDGLDQYRLTPLELKQKCKDMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLEWRMKQHAAVLEERVLDPKSTIVAIFPSPMLYAGPTEVQWHCRCRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKIKKAMDFYDPA 574          
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: PAPS1_MOUSE (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Mus musculus GN=Papss1 PE=2 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.635e-82
Identity = 141/203 (69.46%), Postives = 172/203 (84.73%), Query Frame = 2
Query:   20 NWLIGGDLEVLEPIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFKVAAYDKTQGKMAFFD 628
            +WLIGGDL+VL+ I ++DGLD++RL+P +L+ +F   NADAVFAFQLRNPVHNGHALLM DT ++LLE GY+ P+LLLHPLGG+TK DDVPL WRMKQH  VLE+G+LDPETTVV+IFPSPM YAGPTEVQWH +AR+ AGANFYIVGRDPAGM HP   +DLY+  HG KVL+MAPGL  L I+PF+VAAY+K + +M ++D
Sbjct:  374 DWLIGGDLQVLDRIYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGILDPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPTHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYD 576          
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: PAPS1_HUMAN (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens GN=PAPSS1 PE=1 SV=2)

HSP 1 Score: 303.908 bits (777), Expect = 4.756e-82
Identity = 140/203 (68.97%), Postives = 172/203 (84.73%), Query Frame = 2
Query:   20 NWLIGGDLEVLEPIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFKVAAYDKTQGKMAFFD 628
            +WLIGGDL+VL+ + ++DGLD++RL+P +L+ +F   NADAVFAFQLRNPVHNGHALLM DT ++LLE GY+ P+LLLHPLGG+TK DDVPL WRMKQH  VLE+GVL+PETTVV+IFPSPM YAGPTEVQWH +AR+ AGANFYIVGRDPAGM HP   +DLY+  HG KVL+MAPGL  L I+PF+VAAY+K + +M ++D
Sbjct:  374 DWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGVLNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPSHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYD 576          
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: PAPS1_CAVPO (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Cavia porcellus GN=PAPSS1 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.171e-80
Identity = 139/203 (68.47%), Postives = 170/203 (83.74%), Query Frame = 2
Query:   20 NWLIGGDLEVLEPIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFKVAAYDKTQGKMAFFD 628
            +WLIGGDL+VL+ I ++DGLD++RL+P +L+ +F   NADAVFAFQLRNPVHNGHALLM DT R+LLE GY+ P+LLLHPLGG+TK DDVPL WRMKQH  VLE+G+L+PE+TVV+IFPSPM YAGPT VQWH +AR+ AGANFYIVGRDPAGM HP   +DLY   HG KVL+MAPGL  L I+PF+VAAY+K + +M ++D
Sbjct:  374 DWLIGGDLQVLDRIYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHRQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGILNPESTVVAIFPSPMMYAGPTGVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYKPTHGAKVLTMAPGLITLEIVPFRVAAYNKRKKRMDYYD 576          
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: MET3_SCHPO (Sulfate adenylyltransferase OS=Schizosaccharomyces pombe GN=sua1 PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 1.316e-23
Identity = 67/194 (34.54%), Postives = 104/194 (53.61%), Query Frame = 2
Query:   14 ARNWLIGGDLEVLEPIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFKVAAY 595
            A N  +GG L+ + PI++ D ++ +R SPAQLR +F + N + V AFQ RNP+H  H  L   T R   + G +   +L+HP+ G TK  D+    R++ +E +L+       +  +S+ P  M  AGP E  WHA  R N GA+ +I+GRD AG G   +  D Y     + ++        + I+PF++  Y
Sbjct:  147 AGNVYVGGKLQAVTPIRHFDFVE-YRYSPAQLRSDFQRNNWNRVVAFQTRNPMHRAHREL---TVRAAKQHGAR---VLIHPVVGMTKPGDIDHFTRVRVYEAILQR--YPKGSAKLSLLPLAMRMAGPREALWHAIIRKNYGASHFIIGRDHAGPGKNSQGEDFYGPYDAQYLVEQYAQEIGITIVPFQMMTY 331          
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: SAT_SYMTH (Sulfate adenylyltransferase OS=Symbiobacterium thermophilum GN=sat PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.719e-23
Identity = 66/167 (39.52%), Postives = 98/167 (58.68%), Query Frame = 2
Query:   29 IGGDLEVLE--PIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGH---PVEKRDLYD 514
            +GG++ +L+  P  + +    +RL+PA+ R EF++R    V  FQ RNPVH  H  +    ++  LE+      LLLHPL G TK DD+P + RM+ +E +LE G    E  ++++FP+ M YAGP E  WHA  R N G   +IVGRD AG+G    P + + ++D
Sbjct:  154 LGGEVWLLDRPPAPFAE----YRLTPAETRAEFARRGWRTVVGFQTRNPVHRAHEYI----QKCALEICDG---LLLHPLVGETKDDDLPAAVRMRAYEAILE-GYFPRERILLAVFPAAMRYAGPREAVWHALCRKNYGCTHFIVGRDHAGVGSFYGPYDAQRIFD 308          
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: SAT_HALOH (Sulfate adenylyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=sat PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.719e-23
Identity = 70/199 (35.18%), Postives = 101/199 (50.75%), Query Frame = 2
Query:   26 LIGGDLEVLEPIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVL-SMAPGLERLNILPFKVAAYDKTQGKMA 619
            L+GG + ++  +KY D  + +RL+PA+ R++  ++    V  FQ RNP+H  H  L       +         L L PL G TKA D+P   R+K +E VL D     + T++ +FP+ MHYAGP E  +HA  R N G   +IVGRD AG+G      D Y     +K+     P    +  L F+ + Y K  G MA
Sbjct:  151 LLGGKISLINRLKYDD-FNNYRLTPAETREKIKEKGWQTVVGFQTRNPIHRAHEYLQKCALETV-------DGLFLSPLVGRTKASDIPADIRIKSYEVVL-DKFYPRDRTMMVVFPAAMHYAGPREAIFHALCRKNYGCTHFIVGRDHAGVG------DYYGTYDAQKIFDEFDPEEIGITPLKFEYSFYCKKCGGMA 334          
BLAST of FC868805 vs. ExPASy Swiss-Prot
Match: SATC_AQUAE (Probable bifunctional SAT/APS kinase OS=Aquifex aeolicus GN=sat/cysC PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.002e-23
Identity = 66/191 (34.55%), Postives = 101/191 (52.88%), Query Frame = 2
Query:   23 WLIGGDLEVLEPIKYHDGLDRFRLSPAQLRDEFSKRNADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYQNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFKVAAY 595
            + I G+L+V++  KY+D    +R +P Q+R+E      D + AFQ RNP+H  H  L   T+R + ++G     LLLHP+ G TK  DV +  RM+ + KVL +   D + T+++  P  M  AGP E  WH   R N GA  +IVGRD A  G   + +  YD    +++         + ++PF+   Y
Sbjct:  127 YYISGELKVIQLPKYYD-FPEYRKTPKQVREEIKSLGLDKIVAFQTRNPMHRVHEEL---TKRAMEKVGGG---LLLHPVVGLTKPGDVDVYTRMRIY-KVLYEKYYDKKKTILAFLPLAMRMAGPREALWHGIIRRNYGATHFIVGRDHASPGKDSKGKPFYDPYEAQELFKKYEDEIGIKMVPFEELVY 309          
The following BLAST results are available for this feature:
BLAST of FC868805 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
PAPSS_URECA3.183e-8672.06Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
PAPS2_HUMAN7.839e-8569.76Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
PAPS2_MOUSE4.302e-8369.27Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
PAPS1_MOUSE1.635e-8269.46Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
PAPS1_HUMAN4.756e-8268.97Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
PAPS1_CAVPO1.171e-8068.47Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
MET3_SCHPO1.316e-2334.54Sulfate adenylyltransferase OS=Schizosaccharomyces... [more]
SAT_SYMTH1.719e-2339.52Sulfate adenylyltransferase OS=Symbiobacterium the... [more]
SAT_HALOH1.719e-2335.18Sulfate adenylyltransferase OS=Halothermothrix ore... [more]
SATC_AQUAE5.002e-2334.55Probable bifunctional SAT/APS kinase OS=Aquifex ae... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005A04EF AbioticL1 Citrus clementina cDNA clone C31005A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868805 ID=FC868805|Name=FC868805|organism=Citrus clementina|type=EST|length=656bp
GGCCATAACTTATGCCCGAAATTGGCTGATTGGAGGTGACTTGGAGGTGC
TAGAACCAATCAAGTACCACGATGGTCTTGATCGTTTCCGATTGTCACCT
GCTCAACTTCGTGATGAATTCAGCAAGCGCAATGCCGATGCTGTGTTTGC
TTTCCAGCTTAGGAATCCTGTGCACAATGGTCATGCTCTATTGATGACTG
ATACCCGTCGTAGGCTTCTTGAGATGGGTTACCAGAATCCTATCCTCTTG
CTACACCCATTAGGAGGCTATACAAAGGCAGATGATGTTCCCCTTAGTTG
GCGAATGAAGCAACATGAAAAGGTGCTTGAGGATGGTGTTCTTGATCCAG
AGACCACTGTGGTTTCTATATTTCCCTCTCCCATGCACTACGCAGGCCCA
ACTGAGGTGCAATGGCATGCAAAAGCTAGGATTAATGCTGGGGCCAACTT
TTATATTGTTGGTAGGGACCCAGCTGGCATGGGCCACCCAGTTGAGAAGA
GAGATCTCTACGACGCTGACCATGGCAAAAAGGTACTGAGCATGGCTCCT
GGACTAGAGCGGCTAAACATCCTTCCTTTCAAGGTTGCAGCGTATGACAA
GACTCAAGGCAAAATGGCATTCTTTGATCCTTCAGGGCTAAGGACTTCCT
CTTCAT
back to top