FC868809

Overview
NameFC868809
Unique NameFC868809
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9402 contig Ccv1_Contig9402:1..715. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868809 vs. ExPASy Swiss-Prot
Match: XCT_ARATH (Protein XAP5 CIRCADIAN TIMEKEEPER OS=Arabidopsis thaliana GN=XCT PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 7.881e-48
Identity = 102/196 (52.04%), Postives = 114/196 (58.16%), Query Frame = 2
Query:   74 MSGMGDGYVGTAQDAVRIRRLEKQREAERRKIQELKTKSVSDKGQPGLLQFGSSTSEILETAFKKETVGLVTREEYVEKRVNIRN-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNSRLSFADDFXXXXXXXXXXXXXLKTKRLAQAKLGKDPTVETSFLPDXXXXXXXXXXXXXXXXXXXXXXXXIRNEPLQ 658
            MSGMGDGYVGTAQDAVRIRRL+KQREAER+KIQELK+KS S   Q GLLQFG+S+ EIL+TAFKKETVGLVTREEYVEKRVNIRN                                G+SRLSFA+DF               T  L   KLGKDP+VET+FLPD                        I+NEPL+
Sbjct:    1 MSGMGDGYVGTAQDAVRIRRLQKQREAERKKIQELKSKSASGNDQSGLLQFGTSSCEILDTAFKKETVGLVTREEYVEKRVNIRNKFEEEEKEKLQKLQQEEEELQLEKRNKKRKIKGSSRLSFAEDFENGSDEDDGENKSSGTGNLRCGKLGKDPSVETNFLPDSEREAEEQAERERLKKQWLREQEQIKNEPLE 196          

HSP 2 Score: 40.817 bits (94), Expect = 7.881e-48
Identity = 17/19 (89.47%), Postives = 17/19 (89.47%), Query Frame = 1
Query:  658 ITYSYWDGAXHRRVIQVRK 714
            ITYSYWDG  HRRVIQVRK
Sbjct:  197 ITYSYWDGTGHRRVIQVRK 215          
BLAST of FC868809 vs. ExPASy Swiss-Prot
Match: XCT_ORYSJ (Protein XAP5 CIRCADIAN TIMEKEEPER OS=Oryza sativa subsp. japonica GN=XCT PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.553e-47
Identity = 102/194 (52.58%), Postives = 109/194 (56.19%), Query Frame = 2
Query:   74 MSGMGDGYVGTAQDAVRIRRLEKQREAERRKIQELKTKSVSDKGQPGLLQFGSSTSEILETAFKKETVGLVTREEYVEKRVNIRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNSRLSFADDFXXXXXXXXXXXXXLKTKRLAQAKLGKDPTVETSFLPDXXXXXXXXXXXXXXXXXXXXXXXXIRNEPL 655
            MSG GDGYVGTAQDAV+IRRLEKQREAERRKI+ELK KS    GQPGLLQFGSSTSEILETAFKKETVGLVTRE+YVEKRVNIR                                G+ RLSF D+                 K+    KLGKDPTVETSFLPD                        I+NEPL
Sbjct:    1 MSGFGDGYVGTAQDAVKIRRLEKQREAERRKIEELKNKS--SDGQPGLLQFGSSTSEILETAFKKETVGLVTREQYVEKRVNIRTKIEEEEKEKLQKLQQEEEELQMQKRKKRRVRGDPRLSFCDEIENGSDEDEFENQE-PQKKHGPVKLGKDPTVETSFLPDREREAEEQAERERLKKQWSREQELIKNEPL 191          

HSP 2 Score: 41.2022 bits (95), Expect = 8.553e-47
Identity = 17/20 (85.00%), Postives = 18/20 (90.00%), Query Frame = 1
Query:  655 SITYSYWDGAXHRRVIQVRK 714
            +ITYSYWDG  HRRVIQVRK
Sbjct:  192 TITYSYWDGTGHRRVIQVRK 211          
BLAST of FC868809 vs. ExPASy Swiss-Prot
Match: XCT_ORYSI (Protein XAP5 CIRCADIAN TIMEKEEPER OS=Oryza sativa subsp. indica GN=XCT PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.553e-47
Identity = 102/194 (52.58%), Postives = 109/194 (56.19%), Query Frame = 2
Query:   74 MSGMGDGYVGTAQDAVRIRRLEKQREAERRKIQELKTKSVSDKGQPGLLQFGSSTSEILETAFKKETVGLVTREEYVEKRVNIRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNSRLSFADDFXXXXXXXXXXXXXLKTKRLAQAKLGKDPTVETSFLPDXXXXXXXXXXXXXXXXXXXXXXXXIRNEPL 655
            MSG GDGYVGTAQDAV+IRRLEKQREAERRKI+ELK KS    GQPGLLQFGSSTSEILETAFKKETVGLVTRE+YVEKRVNIR                                G+ RLSF D+                 K+    KLGKDPTVETSFLPD                        I+NEPL
Sbjct:    1 MSGFGDGYVGTAQDAVKIRRLEKQREAERRKIEELKNKS--SDGQPGLLQFGSSTSEILETAFKKETVGLVTREQYVEKRVNIRTKIEEEEKEKLQKLQQEEEELQMQKRKKRRVRGDPRLSFCDEIENGSDEDEFENQE-PQKKHGPVKLGKDPTVETSFLPDREREAEEQAERERLKKQWSREQELIKNEPL 191          

HSP 2 Score: 41.2022 bits (95), Expect = 8.553e-47
Identity = 17/20 (85.00%), Postives = 18/20 (90.00%), Query Frame = 1
Query:  655 SITYSYWDGAXHRRVIQVRK 714
            +ITYSYWDG  HRRVIQVRK
Sbjct:  192 TITYSYWDGTGHRRVIQVRK 211          
The following BLAST results are available for this feature:
BLAST of FC868809 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
XCT_ARATH7.881e-4852.04Protein XAP5 CIRCADIAN TIMEKEEPER OS=Arabidopsis t... [more]
XCT_ORYSJ8.553e-4752.58Protein XAP5 CIRCADIAN TIMEKEEPER OS=Oryza sativa ... [more]
XCT_ORYSI8.553e-4752.58Protein XAP5 CIRCADIAN TIMEKEEPER OS=Oryza sativa ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31005A09EF AbioticL1 Citrus clementina cDNA clone C31005A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868809 ID=FC868809|Name=FC868809|organism=Citrus clementina|type=EST|length=714bp
CTTGCCGGGGGGTAGCCATCGAGAAATCGAGATCGGCAGAACTGCTACCG
AGAGAAACACACAGCAAATCAAGATGTCGGGTATGGGAGATGGGTACGTG
GGCACGGCCCAAGACGCGGTGAGGATCCGGAGACTCGAGAAGCAAAGAGA
AGCCGAGCGTCGCAAAATCCAAGAGCTCAAAACGAAGTCCGTCTCCGACA
AGGGCCAGCCCGGTCTCCTCCAGTTTGGTTCAAGTACCTCCGAGATTCTA
GAAACTGCGTTTAAGAAGGAAACCGTAGGTTTAGTCACCAGAGAGGAATA
CGTTGAGAAGAGGGTTAATATTCGGAACAAGATTGAAGAGGAAGAAAAGG
AGAAGCTTCAGAAGCTACTACAAGAGGAAGAGGAGCTGCAATTGGAAAAG
CGTAAAAAGCGAAAGATTAAGGGAAATTCTCGATTATCATTTGCTGATGA
TTTTGAGAGTGAAAATGAAGAGGAGAATGGAGAAATTGAAAATTTGAAAA
CAAAGAGGCTTGCGCAAGCGAAATTGGGAAAAGATCCAACGGTGGAGACT
AGCTTTTTGCCTGACAGTGAGAGAGAGGCAGAGGAGCAATCTGAGCGTGA
ACGGTTGCAGCGACAGTGGCTTCGTGAGCAGGAGCAAATTCGAAATGAGC
CCCTTCAATCACTTATAGTTATTGGGATGGAGCANGCCATAGACGAGTTA
TCCAGGTTCGGAAG
back to top