FC868814

Overview
NameFC868814
Unique NameFC868814
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7605 contig Ccv1_Contig7605:12..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: FABG_STAES (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.331e-21
Identity = 58/171 (33.92%), Postives = 105/171 (61.40%), Query Frame = 3
Query:   72 VSRTVLITGVSRGLGRALAQELAKRGHTV-IGCSRTQDKLTSLQSELPNPDHHLF-LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            ++++ L+TG SRG+GR++A +LA+ G+ V +  + ++DK  ++  E+       F +  ++     V+E+ + VV + G  D++VNNAG I K+N +  +  +E+D VIDTN+KG+ N ++   P M+  + G I+N++S  G  G    A Y A+K  V GL+++ A+E+
Sbjct:    1 MNKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKDKAEAVVEEIKAKGVESFAIQANVAKGDEVKEMIKEVVSQFGSVDVLVNNAG-ITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGAIINLTSIVGAMGNPGQANYVATKAGVIGLTKTAAREL 170          
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: FABG_STAEQ (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.331e-21
Identity = 58/171 (33.92%), Postives = 105/171 (61.40%), Query Frame = 3
Query:   72 VSRTVLITGVSRGLGRALAQELAKRGHTV-IGCSRTQDKLTSLQSELPNPDHHLF-LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            ++++ L+TG SRG+GR++A +LA+ G+ V +  + ++DK  ++  E+       F +  ++     V+E+ + VV + G  D++VNNAG I K+N +  +  +E+D VIDTN+KG+ N ++   P M+  + G I+N++S  G  G    A Y A+K  V GL+++ A+E+
Sbjct:    1 MNKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKDKAEAVVEEIKAKGVESFAIQANVAKGDEVKEMIKEVVSQFGSVDVLVNNAG-ITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGAIINLTSIVGAMGNPGQANYVATKAGVIGLTKTAAREL 170          
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: YOXD_BACSU (Uncharacterized oxidoreductase yoxD OS=Bacillus subtilis GN=yoxD PE=3 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 8.628e-21
Identity = 63/168 (37.50%), Postives = 95/168 (56.55%), Query Frame = 3
Query:   78 RTVLITGVSRGLGRALAQELAKRGHTVIGCSRTQDKLTSLQSELPNPD-HHLFLNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            +T LITG  RG+GRA A  LAK G  +    RT   +  +  E+        F   D++    V +    V E+ G  DI++NNAG I+K     D+S +E++ +I  N+ G+ ++ R  +P MI  K G I+N+SS  G+ GAA+ + Y ASK+AV GL+ S+ +EV
Sbjct:    7 KTALITGGGRGIGRATALALAKEGVNIGLIGRTSANVEKVAEEVKALGVKAAFAAADVKDADQVNQAVAQVKEQLGDIDILINNAG-ISKFGGFLDLSADEWENIIQVNLMGVYHVTRAVLPEMIERKAGDIINISSTAGQRGAAVTSAYSASKFAVLGLTESLMQEV 173          
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: FABG_STAAW (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.279e-20
Identity = 57/171 (33.33%), Postives = 104/171 (60.82%), Query Frame = 3
Query:   72 VSRTVLITGVSRGLGRALAQELAKRGHTV-IGCSRTQDKLTSLQSELPNPDHHLF-LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            ++++ L+TG SRG+GR++A +LA+ G+ V +  + +++K  ++  E+       F +  ++     V+ + + VV + G  D++VNNAG I ++N +  +  +E+D VIDTN+KG+ N ++   P M+  + G I+N+SS  G  G    A Y A+K  V GL++S A+E+
Sbjct:    3 MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAG-ITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAAREL 172          
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: FABG_STAAS (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.279e-20
Identity = 57/171 (33.33%), Postives = 104/171 (60.82%), Query Frame = 3
Query:   72 VSRTVLITGVSRGLGRALAQELAKRGHTV-IGCSRTQDKLTSLQSELPNPDHHLF-LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            ++++ L+TG SRG+GR++A +LA+ G+ V +  + +++K  ++  E+       F +  ++     V+ + + VV + G  D++VNNAG I ++N +  +  +E+D VIDTN+KG+ N ++   P M+  + G I+N+SS  G  G    A Y A+K  V GL++S A+E+
Sbjct:    3 MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAG-ITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAAREL 172          
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: FABG_STAAR (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.279e-20
Identity = 57/171 (33.33%), Postives = 104/171 (60.82%), Query Frame = 3
Query:   72 VSRTVLITGVSRGLGRALAQELAKRGHTV-IGCSRTQDKLTSLQSELPNPDHHLF-LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            ++++ L+TG SRG+GR++A +LA+ G+ V +  + +++K  ++  E+       F +  ++     V+ + + VV + G  D++VNNAG I ++N +  +  +E+D VIDTN+KG+ N ++   P M+  + G I+N+SS  G  G    A Y A+K  V GL++S A+E+
Sbjct:    3 MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAG-ITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAAREL 172          
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: FABG_STAAN (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.279e-20
Identity = 57/171 (33.33%), Postives = 104/171 (60.82%), Query Frame = 3
Query:   72 VSRTVLITGVSRGLGRALAQELAKRGHTV-IGCSRTQDKLTSLQSELPNPDHHLF-LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            ++++ L+TG SRG+GR++A +LA+ G+ V +  + +++K  ++  E+       F +  ++     V+ + + VV + G  D++VNNAG I ++N +  +  +E+D VIDTN+KG+ N ++   P M+  + G I+N+SS  G  G    A Y A+K  V GL++S A+E+
Sbjct:    3 MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAG-ITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAAREL 172          
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: FABG_STAAM (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.279e-20
Identity = 57/171 (33.33%), Postives = 104/171 (60.82%), Query Frame = 3
Query:   72 VSRTVLITGVSRGLGRALAQELAKRGHTV-IGCSRTQDKLTSLQSELPNPDHHLF-LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            ++++ L+TG SRG+GR++A +LA+ G+ V +  + +++K  ++  E+       F +  ++     V+ + + VV + G  D++VNNAG I ++N +  +  +E+D VIDTN+KG+ N ++   P M+  + G I+N+SS  G  G    A Y A+K  V GL++S A+E+
Sbjct:    3 MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAG-ITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAAREL 172          
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: FABG_STAAC (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 3.279e-20
Identity = 57/171 (33.33%), Postives = 104/171 (60.82%), Query Frame = 3
Query:   72 VSRTVLITGVSRGLGRALAQELAKRGHTV-IGCSRTQDKLTSLQSELPNPDHHLF-LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            ++++ L+TG SRG+GR++A +LA+ G+ V +  + +++K  ++  E+       F +  ++     V+ + + VV + G  D++VNNAG I ++N +  +  +E+D VIDTN+KG+ N ++   P M+  + G I+N+SS  G  G    A Y A+K  V GL++S A+E+
Sbjct:    3 MTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAG-ITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAAREL 172          
BLAST of FC868814 vs. ExPASy Swiss-Prot
Match: Y2049_STAEQ (Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.593e-20
Identity = 51/173 (29.48%), Postives = 106/173 (61.27%), Query Frame = 3
Query:   60 IGKSVSRTVLITGVSRGLGRALAQELAKRGHTVIGCSRTQDKLTSLQSELPNPDHHLFLNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGIANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKEV 578
            + K   +  ++TG S G+G A+A++L+++G +++   R + +L  +  +L  P   +  +V ++SN  ++++ + V++  G  DI+VN+AG  + ++KI D + E++DT+ID N+KG  ++L+  +P ++    G I+N++S  G       A Y A+K A+  +++S+ KE+
Sbjct:    1 MAKVKEKVAVVTGASSGIGEAIAKKLSQQGASIVLVGRNEQRLNEIAQQLNTPAKVVSADVTVKSN--IDDMLKAVIDHFGHIDIVVNSAGQ-SLSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSSGHIINLASVSGFEPTKTNAVYGATKAAIHAITQSLEKEL 170          
The following BLAST results are available for this feature:
BLAST of FC868814 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 141
Match NameE-valueIdentityDescription
FABG_STAES1.331e-2133.923-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAEQ1.331e-2133.923-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
YOXD_BACSU8.628e-2137.50Uncharacterized oxidoreductase yoxD OS=Bacillus su... [more]
FABG_STAAW3.279e-2033.333-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAS3.279e-2033.333-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAR3.279e-2033.333-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAN3.279e-2033.333-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAM3.279e-2033.333-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAAC3.279e-2033.333-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
Y2049_STAEQ5.593e-2029.48Uncharacterized oxidoreductase SERP2049 OS=Staphyl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005B02EF AbioticL1 Citrus clementina cDNA clone C31005B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868814 ID=FC868814|Name=FC868814|organism=Citrus clementina|type=EST|length=687bp
GGGGGAGAGGGAGGGAAATAACAATAACAACGATGGCAGCAACGACGCCG
TTTAACGGGATAGGGAAGAGCGTATCGCGAACAGTACTGATAACGGGAGT
GAGCAGAGGATTAGGGCGAGCCCTAGCTCAAGAGTTGGCCAAGCGCGGCC
ACACCGTGATCGGCTGCTCCCGCACTCAGGATAAGCTCACCTCCCTCCAA
TCAGAACTCCCTAATCCCGACCACCACCTCTTCCTCAATGTCGACATCAG
GTCAAATAGCAGTGTTGAAGAACTAGCACGTCTTGTCGTGGAGAAGAAAG
GCGTTCCTGATATTATAGTAAACAATGCAGGTACTATTAATAAAAATAAC
AAGATTTGGGATGTTTCGCCAGAAGAATTCGACACTGTTATTGATACTAA
TGTGAAAGGCATAGCAAATATGTTGCGTCACTTCATTCCTTTGATGATTC
CAATCAAGCAAGGGATTATCGTTAATATGTCTTCTGGTTGGGGAAGATCT
GGTGCTGCCCTGGTAGCACCTTATTGTGCTTCAAAATGGGCAGTTGAAGG
GTTGTCCAGATCAGTGGCAAAGGAGGTGCCTGATGGGATGGCAATTGTTG
CTTTAATCCTGGTGTTATTACACTGACATGCTTACGTCCTGCTTTGGCAC
TTCTGCTGCATCATACCAGCACCTGATGCATGGGCTT
back to top