FC868818

Overview
NameFC868818
Unique NameFC868818
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length677
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13299 contig Ccv1_Contig13299:248..924. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CAF1K_ARATH (Probable CCR4-associated factor 1 homolog 11 OS=Arabidopsis thaliana GN=CAF1-11 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 8.576e-66
Identity = 120/168 (71.43%), Postives = 140/168 (83.33%), Query Frame = 3
Query:  174 REVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRPDVDPSTRPYFRQRKPSDHYKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKFIWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            R+VWA NLESEF+LI  +++ YPFISMDTEFPG++Y+ D+D       R+  P+  Y +LKSNVDAL+LIQVGLTLSD+ GNLPDLG   N ++IWEFNFRDFD+  D HAPDSIELLR  GIDFERNR+EGV+S RFAELMMSSGL+CNESVSWVTFHSAYDFGYLV
Sbjct:   15 RDVWAYNLESEFDLIRGIVEDYPFISMDTEFPGVIYKADLD-----VLRRGNPNYLYNLLKSNVDALSLIQVGLTLSDADGNLPDLGGQKNRRYIWEFNFRDFDVERDPHAPDSIELLRRHGIDFERNRREGVESERFAELMMSSGLICNESVSWVTFHSAYDFGYLV 177          
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CAF1I_ARATH (Probable CCR4-associated factor 1 homolog 9 OS=Arabidopsis thaliana GN=CAF1-9 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 8.576e-66
Identity = 123/168 (73.21%), Postives = 140/168 (83.33%), Query Frame = 3
Query:  174 REVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRPDVDPSTRPYFRQRKPSDHYKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKFIWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            REVWA NLESEFELIS++ID YPFISMDTEFPG++++ D+        R   P D Y +LK+NVDAL+LIQVGLTLSD +GNLPDLG   +  FIWEFNFRDFD+A DAHAPDSIELLR QGIDFERN ++GV+S RFAELMMSSGLVCNE VSWVTFHSAYDFGYL+
Sbjct:   20 REVWAENLESEFELISEIIDDYPFISMDTEFPGVIFKSDL--------RFTNPDDLYTLLKANVDALSLIQVGLTLSDVNGNLPDLGDDLHRGFIWEFNFRDFDVARDAHAPDSIELLRRQGIDFERNCRDGVESERFAELMMSSGLVCNEEVSWVTFHSAYDFGYLM 179          
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CAF1G_ARATH (Probable CCR4-associated factor 1 homolog 7 OS=Arabidopsis thaliana GN=CAF1-7 PE=2 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 5.584e-49
Identity = 97/169 (57.40%), Postives = 124/169 (73.37%), Query Frame = 3
Query:  174 REVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRPDVDPSTRPYFRQRKPSDHYKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKF-IWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            REVW  NLESE  LI +V+D +PF++MDTEFPG+V RP     T   +       HY+ LK+NV+ L +IQ+GLT SD  GNLP  G+  +NK+ IW+FNFR+FD+ +D +A DSIELLR  GIDF +N + G+DS RFAEL+MSSG+V NE+V WVTFHS YDFGYL+
Sbjct:   13 REVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY-------HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGT--DNKYCIWQFNFREFDLESDIYATDSIELLRQSGIDFVKNNEFGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLL 172          
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CAF1J_ARATH (Probable CCR4-associated factor 1 homolog 10 OS=Arabidopsis thaliana GN=CAF1-10 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 9.857e-46
Identity = 94/169 (55.62%), Postives = 123/169 (72.78%), Query Frame = 3
Query:  174 REVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRPDVDPSTRPYFRQRKPSDHYKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKF-IWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            REVW  NL  EF LI +++D++ +I+MDTEFPG+V +P    +T  Y        +Y+ LK NVD L LIQVGLT SD +GNLP  G+   +KF IW+FNFR+F+I  D +A +SIELLR  GIDF++N ++G+D VRF ELMMSSG+V N+++SWVTFH  YDFGYLV
Sbjct:   13 REVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKP---VATFKYNNDL----NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGT---DKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNIEKGIDVVRFGELMMSSGIVLNDAISWVTFHGGYDFGYLV 171          
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CAF1F_ARATH (Probable CCR4-associated factor 1 homolog 6 OS=Arabidopsis thaliana GN=CAF1-6 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 6.389e-45
Identity = 90/169 (53.25%), Postives = 118/169 (69.82%), Query Frame = 3
Query:  174 REVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRP-DVDPSTRPYFRQRKPSDHYKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKFIWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            REVW  NL+ E +LI  V+D +P+++MDTEFPG+V RP     S   Y        HY+ LK+NV+ L +IQ+GLT S+  GNLP  G+  +   IW+FNFR+FD+ +D  A DSIELL+  GID  +N  +G+DS RFAEL+MSSG+V NE+V WVTFHS YDFGYL+
Sbjct:   13 REVWNDNLQEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY--------HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGT--DKYCIWQFNFREFDLDSDIFALDSIELLKQSGIDLAKNTLDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLL 171          
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CAF1B_ARATH (Probable CCR4-associated factor 1 homolog 2 OS=Arabidopsis thaliana GN=CAF1-2 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.141e-44
Identity = 90/169 (53.25%), Postives = 118/169 (69.82%), Query Frame = 3
Query:  174 REVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRP-DVDPSTRPYFRQRKPSDHYKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKFIWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            REVW  NLE E  LI Q ID +P+++MDTEFPG+V +    +P+  PY    + +  Y  LK+NV+ L LIQ+GLTLSD  GNLP  G+  N + IW+FNFR+F++ +D  A DSIELLR   ID E+N + GVD+ RFAEL+M SG+V N+ + WVTFH  YDFGYL+
Sbjct:   17 REVWNHNLEQEMALIEQSIDDFPYVAMDTEFPGIVCKTVTANPNPNPYSIHYEYN--YDTLKANVNMLKLIQLGLTLSDEKGNLPTCGT--NKQCIWQFNFREFNVISDMFALDSIELLRKSAIDLEKNNECGVDAKRFAELLMGSGVVLNDKIHWVTFHCGYDFGYLL 181          
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CAF1_SCHPO (Poly(A) ribonuclease pop2 OS=Schizosaccharomyces pombe GN=caf1 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.524e-38
Identity = 81/169 (47.93%), Postives = 113/169 (66.86%), Query Frame = 3
Query:  174 REVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRP-DVDPSTRPYFRQRKPSDHYKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKFIWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            R+VW++NL+ E  LI  +I+RYP +SMDTEFPG+V RP  V  S+  Y        HY+ L++NVD+L +IQ+GL LSD  GN P           W+FNF  F++  D +AP+SIELL   GIDF+++++ G++   FAEL++ SGLV  E V+W+TFHS YDF YL+
Sbjct:   23 RDVWSTNLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLGVFKSSDDY--------HYQTLRANVDSLKIIQIGLALSDEEGNAPV------EACTWQFNFT-FNLQDDMYAPESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLL 176          
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CNOT8_MOUSE (CCR4-NOT transcription complex subunit 8 OS=Mus musculus GN=Cnot8 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.975e-34
Identity = 75/168 (44.64%), Postives = 112/168 (66.67%), Query Frame = 3
Query:  177 EVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRPDVDPSTRPYFRQRKPSDH-YKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKFIWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            EVWASNLE E   I +++  Y +I+MDTEFPG+V         RP    R   D+ Y++L+ NVD L +IQ+GLT ++  G  P   SG N    W+FNF+ F++  D ++ DSI+LL   G+ F+++ +EG+D++ FAEL+M+SG+V  ++V W++FHS YDFGY+V
Sbjct:   14 EVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVV--------VRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYP---SGINT---WQFNFK-FNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMV 166          
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CNOT8_HUMAN (CCR4-NOT transcription complex subunit 8 OS=Homo sapiens GN=CNOT8 PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.975e-34
Identity = 75/168 (44.64%), Postives = 112/168 (66.67%), Query Frame = 3
Query:  177 EVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRPDVDPSTRPYFRQRKPSDH-YKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKFIWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            EVWASNLE E   I +++  Y +I+MDTEFPG+V         RP    R   D+ Y++L+ NVD L +IQ+GLT ++  G  P   SG N    W+FNF+ F++  D ++ DSI+LL   G+ F+++ +EG+D++ FAEL+M+SG+V  ++V W++FHS YDFGY+V
Sbjct:   14 EVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVV--------VRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYP---SGINT---WQFNFK-FNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMV 166          
BLAST of FC868818 vs. ExPASy Swiss-Prot
Match: CNOT7_MOUSE (CCR4-NOT transcription complex subunit 7 OS=Mus musculus GN=Cnot7 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.885e-34
Identity = 76/168 (45.24%), Postives = 109/168 (64.88%), Query Frame = 3
Query:  177 EVWASNLESEFELISQVIDRYPFISMDTEFPGLVYRPDVDPSTRPYFRQRKPSDH-YKVLKSNVDALNLIQVGLTLSDSSGNLPDLGSGGNNKFIWEFNFRDFDIATDAHAPDSIELLRLQGIDFERNRKEGVDSVRFAELMMSSGLVCNESVSWVTFHSAYDFGYLV 677
            EVWA NL+ E + I QVI +Y +++MDTEFPG+V         RP    R  +D+ Y++L+ NVD L +IQ+GLT  +  G  P   S       W+FNF+ F++  D +A DSIELL   GI F+++ +EG+++  FAEL+M+SG+V  E V W++FHS YDFGYL+
Sbjct:   14 EVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVV--------ARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTS------TWQFNFK-FNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLI 166          
The following BLAST results are available for this feature:
BLAST of FC868818 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
CAF1K_ARATH8.576e-6671.43Probable CCR4-associated factor 1 homolog 11 OS=Ar... [more]
CAF1I_ARATH8.576e-6673.21Probable CCR4-associated factor 1 homolog 9 OS=Ara... [more]
CAF1G_ARATH5.584e-4957.40Probable CCR4-associated factor 1 homolog 7 OS=Ara... [more]
CAF1J_ARATH9.857e-4655.62Probable CCR4-associated factor 1 homolog 10 OS=Ar... [more]
CAF1F_ARATH6.389e-4553.25Probable CCR4-associated factor 1 homolog 6 OS=Ara... [more]
CAF1B_ARATH4.141e-4453.25Probable CCR4-associated factor 1 homolog 2 OS=Ara... [more]
CAF1_SCHPO1.524e-3847.93Poly(A) ribonuclease pop2 OS=Schizosaccharomyces p... [more]
CNOT8_MOUSE2.975e-3444.64CCR4-NOT transcription complex subunit 8 OS=Mus mu... [more]
CNOT8_HUMAN2.975e-3444.64CCR4-NOT transcription complex subunit 8 OS=Homo s... [more]
CNOT7_MOUSE3.885e-3445.24CCR4-NOT transcription complex subunit 7 OS=Mus mu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005B06EF AbioticL1 Citrus clementina cDNA clone C31005B06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868818 ID=FC868818|Name=FC868818|organism=Citrus clementina|type=EST|length=677bp
GAACTCTCAAGCATCAGCAGTTTCCAGCAACAGTAAGGACTTTCAAATCT
CACCCACGAAGCGTCGAGCTGCAAGCTATTAGCTGACCATCATCACTCAT
CATGGGAGTTGAAGATTTTTCTACGGATTTAGATTCAAATTCAAATTCCA
GCTCATCGAATTCGATTATAATACGCGAAGTCTGGGCGTCTAATTTGGAA
TCCGAATTCGAACTCATCAGCCAAGTCATCGATCGGTACCCTTTTATTTC
CATGGACACCGAATTCCCCGGTCTTGTCTACCGACCCGATGTGGACCCCT
CCACCAGGCCTTACTTCCGTCAACGCAAGCCGTCCGATCACTACAAGGTT
CTGAAATCCAACGTCGACGCCTTGAACTTGATCCAGGTGGGCCTCACTCT
CTCTGACTCTTCCGGTAACTTGCCGGATTTGGGCTCCGGGGGCAACAATA
AATTCATCTGGGAGTTCAACTTCCGGGACTTCGATATCGCGACGGACGCC
CACGCGCCGGATTCGATAGAGCTGCTGAGACTGCAGGGGATTGACTTTGA
GCGCAACAGGAAGGAAGGCGTTGACTCGGTTCGGTTCGCCGAGTTGATGA
TGTCGTCGGGACTCGTCTGTAACGAATCGGTGAGTTGGGTCACGTTCCAC
AGCGCGTACGATTTCGGGTACCTGGTT
back to top