FC868995

Overview
NameFC868995
Unique NameFC868995
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868995 vs. ExPASy Swiss-Prot
Match: FOLC_BOVIN (Folylpolyglutamate synthase, mitochondrial OS=Bos taurus GN=FPGS PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.210e-15
Identity = 70/235 (29.79%), Postives = 96/235 (40.85%), Query Frame = 2
Query:    2 GIFKYRVPAFTVPQPEEAMRVLEETASKLDVPLQVVPP--XXXXXXXXXXXXXXXEHQYMNAGLAVALSSTWLQRTSQLGINYLDTTSP-LPEQ------------FIQGLTMANLQGRAQIVPDRYTNSETSGDLVFYLDGAHSPESMEICARWFSLAIKEENQQETFDFQXXXXXXXXXXLPQRQHDGKIRKNSAQILLFNCMSVRDPQLLLPSLMKTCARHGVYFKKALFVP 661
            GIFK  VPAFTV QP+E + VL + A ++  PL + PP                 EHQ  NA LA+ ++  WLQ+        L  + P LP Q              QGL      GR Q++          G L +YLDGAH+  SM+ C RWF  A+    + ++                          +  ++LLFN    RD   LL  L++ C      F  A+F P
Sbjct:  243 GIFKSGVPAFTVLQPDEPLAVLRDRAQQISCPLYLCPPLQALEEGGPPLTLGLEGEHQRSNAALALQVARCWLQQKGYQDAGELKASRPSLPGQLPLAPVFQPTPRMQQGLRHTEWPGRTQLL--------RRGPLTWYLDGAHTTSSMQACVRWFRQALHRCERPDS-------------------------GSEVRVLLFNSTGDRDSAALL-KLLQPC-----QFDYAIFCP 438          
BLAST of FC868995 vs. ExPASy Swiss-Prot
Match: FOLC_HUMAN (Folylpolyglutamate synthase, mitochondrial OS=Homo sapiens GN=FPGS PE=1 SV=3)

HSP 1 Score: 79.7221 bits (195), Expect = 1.747e-14
Identity = 71/235 (30.21%), Postives = 93/235 (39.57%), Query Frame = 2
Query:    2 GIFKYRVPAFTVPQPEEAMRVLEETASKLDVPLQVVP--PXXXXXXXXXXXXXXXEHQYMNAGLAVALSSTWLQRTSQLGINYLDTTSP-----LP--------EQFIQGLTMANLQGRAQIVPDRYTNSETSGDLVFYLDGAHSPESMEICARWFSLAIKEENQQETFDFQXXXXXXXXXXLPQRQHDGKIRKNSAQILLFNCMSVRDPQLLLPSLMKTCARHGVYFKKALFVP 661
            GIFK  VPAFTV QPE  + VL + A ++  PL + P                  EHQ  NA LA+ L+  WLQR  + G      + P     LP             GL      GR Q++          G L +YLDGAH+  S + C RWF  A++                       +R   G       ++LLFN    RDP  LL  L++ C      F  A+F P
Sbjct:  245 GIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLCPMLEALEEGGPPLTLGLEGEHQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRTQVL--------RRGPLTWYLDGAHTASSAQACVRWFRQALQGR---------------------ERPSGGP----EVRVLLFNATGDRDPAALL-KLLQPC-----QFDYAVFCP 440          
BLAST of FC868995 vs. ExPASy Swiss-Prot
Match: FOLC_MOUSE (Folylpolyglutamate synthase, mitochondrial OS=Mus musculus GN=Fpgs PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 5.083e-14
Identity = 68/227 (29.96%), Postives = 93/227 (40.97%), Query Frame = 2
Query:    2 GIFKYRVPAFTVPQPEEAMRVLEETASKLDVPLQVVPPXXXXXXXXXXXXXXXE--HQYMNAGLAVALSSTWLQRTSQLGINYLDTTSP-----LPEQFIQGLTMANLQGRAQIVPDRYTNSETSGDLVFYLDGAHSPESMEICARWFSLAIKEENQQETFDFQXXXXXXXXXXLPQRQHDGKIRKNSAQILLFNCMSVRDPQLLLPSLMKTCARHGVYFKKALFVP 661
            GIFK  VPAFTV QPE  + VL + A ++  PL + PP               E  HQ  NA LA+ L+  WL+R     I  L  + P     LP   +   T    +G    V    T     G L +YLDGAH+  S++ C  W+  +++                        ++ DG    +   ILLFN    RD   LL  L++ C      F  A+F P
Sbjct:  245 GIFKPGVPAFTVVQPEGPLAVLRDRAQQIGCPLYLCPPLEALEEVGLPLSLGLEGAHQRSNAALALQLAHCWLERQDHQDIQELKVSRPSIRWQLPLAPVFRPTPHMRRGLRDTVWPGRTQILQRGPLTWYLDGAHTTSSVQACVHWYRQSLER----------------------SKRTDG---GSEVHILLFNSTGDRDSAALL-KLLQPC-----QFDYAVFCP 440          
BLAST of FC868995 vs. ExPASy Swiss-Prot
Match: FOLC_CRIGR (Folylpolyglutamate synthase, mitochondrial OS=Cricetulus griseus GN=FPGS PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.303e-13
Identity = 52/161 (32.30%), Postives = 71/161 (44.10%), Query Frame = 2
Query:    2 GIFKYRVPAFTVPQPEEAMRVLEETASKLDVPLQVVPP--XXXXXXXXXXXXXXXEHQYMNAGLAVALSSTWLQRTSQLGINYLDTTSP-----LP--------EQFIQGLTMANLQGRAQIVPDRYTNSETSGDLVFYLDGAHSPESMEICARWFSLAIK 439
            GIFK  VPAFTV QPE  + VL + A +   PL + PP                 EHQ  NA LA+ L+  WL++     I  L  + P     LP             GL      GR Q++          G L +YLDGAH+  S++ C RW+  +++
Sbjct:  245 GIFKPGVPAFTVLQPEGPLAVLRDRAQQTSCPLYLCPPLEALEDGGLPLTLGLEGEHQRSNAALALQLAHCWLEQQDHQDIRELKVSRPSMRWQLPLAPVFHPTSHMRHGLRDTEWPGRTQVL--------RRGPLTWYLDGAHTTSSVQACVRWYCQSLQ 397          
BLAST of FC868995 vs. ExPASy Swiss-Prot
Match: FOLE_YEAST (Folylpolyglutamate synthase OS=Saccharomyces cerevisiae GN=MET7 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.869e-11
Identity = 49/143 (34.27%), Postives = 69/143 (48.25%), Query Frame = 2
Query:    2 GIFKYRVPAFTVP-QPEEAMRVLEETASKLDVPLQVVPPXXXXXXXXXXXXXXXEHQYMNAGLAVALSSTWLQRTSQLGINY-LDTTSPLPEQFIQGLTMANLQGRAQIVPDRYTNSETSGDLVFYLDGAHSPESMEICARWF 424
            GIFK   PAFTV  QP + + +L+E A +    L  VPP               E Q  NA LAV L+S  L  ++ L       + + +PE+FI GL     +GR Q++          G  V+Y+DGAH+ +SM   + WF
Sbjct:  279 GIFKSGAPAFTVEKQPPQGLTILKERAEERKTTLTEVPPFKQLENVKLGIAG--EFQKSNASLAVMLASEILHTSNILEEKIKCSSNASIPEKFIIGLQNTKWEGRCQVLE--------KGKNVWYIDGAHTKDSMVAASTWF 411          
The following BLAST results are available for this feature:
BLAST of FC868995 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
FOLC_BOVIN1.210e-1529.79Folylpolyglutamate synthase, mitochondrial OS=Bos ... [more]
FOLC_HUMAN1.747e-1430.21Folylpolyglutamate synthase, mitochondrial OS=Homo... [more]
FOLC_MOUSE5.083e-1429.96Folylpolyglutamate synthase, mitochondrial OS=Mus ... [more]
FOLC_CRIGR4.303e-1332.30Folylpolyglutamate synthase, mitochondrial OS=Cric... [more]
FOLE_YEAST6.869e-1134.27Folylpolyglutamate synthase OS=Saccharomyces cerev... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007D06EF AbioticL1 Citrus clementina cDNA clone C31007D06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868995 ID=FC868995|Name=FC868995|organism=Citrus clementina|type=EST|length=727bp
TGGTATCTTTAAGTATCGAGTTCCTGCTTTTACTGTACCTCAGCCTGAAG
AGGCAATGCGTGTACTTGAAGAGACTGCTTCCAAGTTGGATGTACCTCTT
CAAGTAGTACCACCGTTGGATGCAAGTTTGCTGAATGGTTTGAAACTTGG
GCTTGAAGGTGAACATCAATATATGAATGCTGGTCTTGCTGTTGCTCTAA
GTTCTACTTGGCTTCAGAGGACCAGTCAACTCGGAATTAACTACCTGGAT
ACAACAAGTCCGCTTCCTGAGCAGTTCATCCAAGGTCTAACAATGGCCAA
CCTGCAAGGACGGGCTCAGATTGTTCCTGATCGATATACAAACTCTGAAA
CATCTGGAGATTTGGTGTTCTATTTGGATGGAGCACATAGTCCTGAAAGC
ATGGAAATATGTGCAAGATGGTTTTCTCTGGCAATTAAGGAGGAAAATCA
GCAAGAAACCTTTGATTTTCAACCACCAAATAGTTCTGGATCTTCCAATG
GATTGCCACAGAGACAGCATGATGGAAAAATTAGAAAGAACTCTGCACAG
ATTCTGTTGTTCAATTGTATGTCGGTGCGAGATCCTCAGTTGCTTCTTCC
TAGCCTGATGAAAACTTGTGCCAGACATGGTGTTTACTTCAAGAAGGCTC
TGTTTGTGCCAATGCATCAGTGTACAATAGGTTGGATCCCATGCTTTCCC
GCCACTGAGACTCAATCGATCTGTCCT
back to top