FC869029

Overview
NameFC869029
Unique NameFC869029
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_ARATH (Bax inhibitor 1 OS=Arabidopsis thaliana GN=BI-1 PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.004e-75
Identity = 138/215 (64.19%), Postives = 167/215 (77.67%), Query Frame = 3
Query:   72 MDAFSSYFESRNGEARW--ESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNIGGLLTVFAMIGSMVWLLATPSYEEKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHALT 710
            MDAFSS+F+S+ G   W  +SLKNF QISP VQ+HLK+VYL+LCCALVASA G YLH+LWNIGG+LT    IG+M+WLL+ P YE +KR SLL  +A+ +GAS+GPLI +AI +DPSILI+AFVGT +AF CFS AAM+ARRREY                  FASSIFGGS +IFKFELYFGLL+FVGY+VVDTQ+IIEKAH GD+D  +H+LT
Sbjct:    1 MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLWNIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILITAFVGTAIAFVCFSAAAMLARRREYLYLGGLLSSGLSMLMWLQFASSIFGGSASIFKFELYFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLT 215          
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_ORYSJ (Bax inhibitor 1 OS=Oryza sativa subsp. japonica GN=BI1 PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.078e-61
Identity = 119/216 (55.09%), Postives = 151/216 (69.91%), Query Frame = 3
Query:   72 MDAFSSYFESRNGEAR---WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNIGGLLTVFAMIGSMVWLLATPSYEEKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHALT 710
            MDAF S   +    A    ++SLKNF QISP VQSHLK VYL+LC AL ASA G YLH+  NIGG+LT+   +GS+ WL + P +EE+KR  +L+A AL +GAS+GPLI LA+  D SIL++AFVGT +AF CF+ AA+VA+RREY                  FA+SIFG ST  F FE+YFGLL+F+GY+V DTQ+IIE+AH GD+D  +HALT
Sbjct:    1 MDAFYSTSSAYGAAASGWGYDSLKNFRQISPAVQSHLKLVYLTLCVALAASAVGAYLHVALNIGGMLTMLGCVGSIAWLFSVPVFEERKRFGILLAAALLEGASVGPLIKLAVDFDSSILVTAFVGTAIAFGCFTCAAIVAKRREYLYLGGLLSSGLSILLWLQFAASIFGHSTGSFMFEVYFGLLIFLGYMVYDTQEIIERAHHGDMDYIKHALT 216          
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_BOVIN (Bax inhibitor 1 OS=Bos taurus GN=TMBIM6 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.118e-33
Identity = 79/200 (39.50%), Postives = 115/200 (57.50%), Query Frame = 3
Query:  120 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHAL 707
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++ +    GLL+    +G M+WL+ATP S+E E+KR  LL   A   G  +GP +DL I I+PSIL +AF+GT + F CF+++A+ ARRR Y                     ++F GS  +F+  LY GL+V  G+++ DTQ IIEKA  GD D   H +
Sbjct:   10 FDALFKFSHITPSTQQHLKKVYASFALCMFVAAAGAYIHVVTHFIQAGLLSALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALDLCIAINPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSAMSLMLLSSL-GNLFFGSVWLFQANLYMGLVVMCGFVLFDTQLIIEKAENGDKDYIWHCV 208          
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_PIG (Bax inhibitor 1 OS=Sus scrofa GN=TMBIM6 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.718e-33
Identity = 79/200 (39.50%), Postives = 114/200 (57.00%), Query Frame = 3
Query:  120 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHAL 707
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++      GLL+    +G M+WL+ATP S+E E+KR  LL   A   G  +GP +DL I I+PSIL +AF+GT + F CF+++A+ ARRR Y                     ++F GS  +F+  LY GL+V  G+++ DTQ IIEKA  GD D   H +
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALDLCIAINPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSAMSLMVLSSL-GNLFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAENGDKDYIWHCV 208          
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_MOUSE (Bax inhibitor 1 OS=Mus musculus GN=Tmbim6 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 6.161e-33
Identity = 78/200 (39.00%), Postives = 114/200 (57.00%), Query Frame = 3
Query:  120 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHAL 707
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++ +    GLL+    +  M+WL+ATP S+E E+KR  LL   A   G  +GP ++L I ++PSIL +AF+GT + F CFS++A+ ARRR Y                     ++F GS  +F+  LY GLLV  G+++ DTQ IIEKA  GD D   H +
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMLLSSL-GNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCV 208          
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_PAROL (Probable Bax inhibitor 1 OS=Paralichthys olivaceus GN=tmbim6 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.051e-32
Identity = 77/200 (38.50%), Postives = 112/200 (56.00%), Query Frame = 3
Query:  120 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP--SYEEKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHAL 707
            ++SL  F QIS   Q HLK VY SL   +  +A G Y+H++  +  GG+L+V   +G M WL  TP  S  EKKR ++L   A   G  + P +D  I I+PSI+++AF+GT + F CF+++A+ A+RR Y                    +  F GS  +FK  +Y GLL+  G+++ DTQ IIEKA  GD D   H++
Sbjct:   10 FDSLFKFSQISHSTQVHLKNVYSSLAVCMFVAAAGSYVHVVTRLFQGGMLSVLGSLGMMFWLAMTPHNSETEKKRLAILAGFAFLTGVGLCPTLDFVIAINPSIIVTAFLGTSVIFVCFTLSALYAKRRSYLFLGGTLMSGLSILFLMSMMNMFF-GSVMLFKAHMYLGLLIMCGFVLXDTQLIIEKAENGDKDYVWHSV 208          
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_RAT (Bax inhibitor 1 OS=Rattus norvegicus GN=Tmbim6 PE=2 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 1.518e-31
Identity = 78/200 (39.00%), Postives = 112/200 (56.00%), Query Frame = 3
Query:  120 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHAL 707
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++      GLL+    +  M+ L+ATP S+E E+KR  LL   A   G  +GP ++L I I+PSIL +AF+GT + F CFS++A+ ARRR Y                     ++F GS  +F+  LY GLLV  G+++ DTQ IIEKA  GD D   H +
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGALALMICLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAINPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMFVSSL-GNLFFGSIWLFQANLYMGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCI 208          
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_HUMAN (Bax inhibitor 1 OS=Homo sapiens GN=TMBIM6 PE=1 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 1.518e-31
Identity = 75/200 (37.50%), Postives = 113/200 (56.50%), Query Frame = 3
Query:  120 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHAL 707
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++ +    GLL+    +  M+WL+ATP S+E E+KR  LL   A   G  +GP ++  I ++PSIL +AF+GT + F CF+++A+ ARRR Y                     ++F GS  +F+  LY GL+V  G+++ DTQ IIEKA  GD D   H +
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSL-GNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCI 208          
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_PONAB (Bax inhibitor 1 OS=Pongo abelii GN=TMBIM6 PE=2 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 1.982e-31
Identity = 75/200 (37.50%), Postives = 113/200 (56.50%), Query Frame = 3
Query:  120 WESLKNFHQISPVVQSHLKQVYLSLCCALVASATGVYLHLLWNI--GGLLTVFAMIGSMVWLLATP-SYE-EKKRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHAL 707
            +++L  F  I+P  Q HLK+VY S    +  +A G Y+H++ +    GLL+    +  M+WL+ATP S+E E+KR  LL   A   G  +GP ++  I ++PSIL +AF+GT + F CF+++A+ ARRR Y                     ++F GS  +F+  LY GL+V  G+++ DTQ IIEKA  GD D   H +
Sbjct:   10 FDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCITVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSL-GNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCI 208          
BLAST of FC869029 vs. ExPASy Swiss-Prot
Match: BI1_DROME (Probable Bax inhibitor 1 OS=Drosophila melanogaster GN=CG7188 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.525e-15
Identity = 56/190 (29.47%), Postives = 92/190 (48.42%), Query Frame = 3
Query:  153 PVVQSHLKQVYLSLCCALVASATGVYLHLLWNIGGLLTVFAMIGSMVWLLATPSYEEK-----KRASLLMATALFKGASIGPLIDLAIQIDPSILISAFVGTGLAFACFSVAAMVARRREYXXXXXXXXXXXXXXXXXHFASSIFGGSTAIFKFELYFGLLVFVGYIVVDTQDIIEKAHFGDLDXCQHAL 707
            P V+ HL +VY+ L     A+A G  L +   +   L V A + ++V +L    Y++       R  +L A     G ++GPL+     I+P+I++SA  GT + F   S++A++A + +Y                    + +F  S  +   +LY G+ V   +IV DTQ+I+EK   G+ D  QHAL
Sbjct:   25 PYVREHLSKVYMVLGSTAAATAMGAMLQMRDFLD--LGVLAAVATLVLVLGLHFYKDDGKNYYTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVF-KSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCRNGNRDVVQHAL 211          
The following BLAST results are available for this feature:
BLAST of FC869029 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
BI1_ARATH1.004e-7564.19Bax inhibitor 1 OS=Arabidopsis thaliana GN=BI-1 PE... [more]
BI1_ORYSJ1.078e-6155.09Bax inhibitor 1 OS=Oryza sativa subsp. japonica GN... [more]
BI1_BOVIN2.118e-3339.50Bax inhibitor 1 OS=Bos taurus GN=TMBIM6 PE=2 SV=1[more]
BI1_PIG4.718e-3339.50Bax inhibitor 1 OS=Sus scrofa GN=TMBIM6 PE=2 SV=1[more]
BI1_MOUSE6.161e-3339.00Bax inhibitor 1 OS=Mus musculus GN=Tmbim6 PE=2 SV=... [more]
BI1_PAROL1.051e-3238.50Probable Bax inhibitor 1 OS=Paralichthys olivaceus... [more]
BI1_RAT1.518e-3139.00Bax inhibitor 1 OS=Rattus norvegicus GN=Tmbim6 PE=... [more]
BI1_HUMAN1.518e-3137.50Bax inhibitor 1 OS=Homo sapiens GN=TMBIM6 PE=1 SV=... [more]
BI1_PONAB1.982e-3137.50Bax inhibitor 1 OS=Pongo abelii GN=TMBIM6 PE=2 SV=... [more]
BI1_DROME1.525e-1529.47Probable Bax inhibitor 1 OS=Drosophila melanogaste... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007G05EF AbioticL1 Citrus clementina cDNA clone C31007G05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869029 ID=FC869029; Name=FC869029; organism=Citrus clementina; type=EST; length=710bp
GAATTTGGGATCGACTCCATCCGAATTTTCTCGAGTTTTCTTTTTCGGAC
AAGCAACGTCAATAATCAAGAATGGATGCTTTCTCTTCCTACTTCGAGTC
TCGTAACGGCGAAGCCCGCTGGGAGTCCTTGAAAAACTTTCACCAGATCT
CTCCCGTCGTCCAGTCTCACCTTAAGCAGGTTTATCTGTCATTATGCTGT
GCACTGGTGGCATCAGCCACTGGAGTCTACCTCCATCTCCTCTGGAACAT
TGGTGGCTTACTTACGGTTTTTGCAATGATTGGATCAATGGTTTGGCTTC
TCGCAACCCCTAGTTATGAAGAGAAAAAGAGGGCTTCTCTGCTCATGGCT
ACCGCTCTCTTTAAAGGTGCATCAATTGGTCCTTTGATTGATCTCGCCAT
TCAAATTGACCCAAGCATTCTGATATCTGCATTTGTGGGAACCGGGCTGG
CTTTCGCTTGTTTTTCTGTAGCTGCCATGGTTGCAAGGCGGAGAGAGTAT
CTCTATCTTGGTGGCTTGCTTTCATCAGGCCTGTCCATGCTTCTTTGGTT
GCATTTTGCTTCCTCTATCTTTGGTGGTTCAACAGCTATCTTCAAGTTTG
AGTTATACTTTGGGCTGTTGGTGTTTGTTGGCTACATCGTGGTGGATACC
CAGGATATAATTGAGAAAGCTCACTTTGGAGACTTGGATTNATGTCAGCA
TGCCCTGACT
back to top