FC869032

Overview
NameFC869032
Unique NameFC869032
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length701
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869032 vs. ExPASy Swiss-Prot
Match: PSBS_SPIOL (Photosystem II 22 kDa protein, chloroplastic OS=Spinacia oleracea GN=PSBS PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 2.279e-40
Identity = 105/204 (51.47%), Postives = 123/204 (60.29%), Query Frame = 1
Query:   88 MAQTMLLMS-GVSTSHAGNLKRDSLVTFQTQMLRPKPF-SHLMFNPLSNEXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXVESKPKVEDXXXXXXXXXXXXKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDEPTGLGGAVIPPGKSLRSALGLRKEVP 693
            MAQ MLLM  GVST++  +LKR++L+  Q Q ++PK   S+L F+PL +                                  + K KVED            K+NELFVGRVAMIGFAASLLGEGITGKGIL+QLNLETGIPIYEAEP           GAIGALGDRG+FVDEP   TGL  AVIPPGK +RSALGL+ + P
Sbjct:    1 MAQAMLLMMPGVSTTNTIDLKRNALLKLQIQKIKPKSSTSNLFFSPLPSSSSSSSTVFKTLALFKSKAKAPKKVE--------KPKLKVEDGLFGTSGGIGFTKENELFVGRVAMIGFAASLLGEGITGKGILSQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGRFVDEP--TTGLEKAVIPPGKDVRSALGLKTKGP 194          

HSP 2 Score: 74.3294 bits (181), Expect = 6.910e-13
Identity = 40/75 (53.33%), Postives = 48/75 (64.00%), Query Frame = 1
Query:  391 KQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDE 615
            K NELFVGR+A +GFA SL+GE ITGKG LAQLN+ETG+PI E EP            AI      GKF+ + +E
Sbjct:  200 KSNELFVGRLAQLGFAFSLIGEIITGKGALAQLNIETGVPINEIEPLVLLNVVFFFIAAINP--GTGKFITDDEE 272          
BLAST of FC869032 vs. ExPASy Swiss-Prot
Match: PSBS_SOLLC (Photosystem II 22 kDa protein, chloroplastic OS=Solanum lycopersicum GN=PSBS PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.358e-37
Identity = 101/204 (49.51%), Postives = 110/204 (53.92%), Query Frame = 1
Query:   88 MAQTMLLMSGVSTSHAGNLKRDSLVTFQTQMLRPKPFSHLMFN--PLSNEXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXVESKPKVEDXXXXXXXXXXXXKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDEPTGLGGAVIPPGKSLRSALGLRKEVP 693
            MAQTMLL +           ++SLV    + L+PKP S L     PL                                    + K KVED            KQNELFVGRVAMIGFAASLLGE ITGKGILAQLNLETGIPIYEAEP           GAIGALGDRGKFVD+P  PTGL  AVIPPGKS +SALGL +  P
Sbjct:    1 MAQTMLLTANAKVDLRS---KESLV----ERLKPKPLSSLFLPSLPLRFSSSSTNASSSKFTSTTVALFKSKAKAPPKKVAPPKEKQKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILAQLNLETGIPIYEAEPLLLFFILFNLLGAIGALGDRGKFVDDPTPPTGLEKAVIPPGKSFKSALGLSEGGP 197          

HSP 2 Score: 70.0922 bits (170), Expect = 1.303e-11
Identity = 38/75 (50.67%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  391 KQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDE 615
            K NELFVGR+A +G A S++GE ITGKG LAQLN ETG+PI E EP            AI      GKF+ + +E
Sbjct:  203 KANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIEPLLLFNIAFFFFAAINP--GTGKFITDEEE 275          
BLAST of FC869032 vs. ExPASy Swiss-Prot
Match: PSBS_TOBAC (Photosystem II 22 kDa protein, chloroplastic OS=Nicotiana tabacum GN=PSBS PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.254e-37
Identity = 97/202 (48.02%), Postives = 108/202 (53.47%), Query Frame = 1
Query:   88 MAQTMLLMSGVSTSHAGNLKRDSLVTFQTQMLRPKPFSHLMFNPLSNEXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXVESKPKVEDXXXXXXXXXXXXKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDEPTGLGGAVIPPGKSLRSALGLRKEVP 693
            MAQTMLL +           ++SLV    + L+PKP S      L  +                   F             + K KVED            KQNELFVGRVAMIGFAASLLGE ITGKGILAQLNLETGIPIYEAEP           GAIGAL DRGKF+D+P  PTGL  AVIPPGK  +SALGL +  P
Sbjct:    1 MAQTMLLTANAKVDLRS---KESLV----ERLKPKPLSSFFLPSLPLKYPSASASASSHFTSTTVALFKSKAKAPAKKVVPKPKEKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILAQLNLETGIPIYEAEPLLLFFILFNLLGAIGALEDRGKFIDDPAPPTGLDKAVIPPGKGFKSALGLSEGGP 195          

HSP 2 Score: 70.4774 bits (171), Expect = 9.977e-12
Identity = 39/75 (52.00%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  391 KQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDE 615
            K NELFVGR+A +G A S++GE ITGKG LAQLN ETG+PI E EP            AI      GKFV + +E
Sbjct:  201 KANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIEPLLLFNIVFFFVAAINP--GTGKFVTDEEE 273          
BLAST of FC869032 vs. ExPASy Swiss-Prot
Match: PSBS_SOLSG (Photosystem II 22 kDa protein, chloroplastic OS=Solanum sogarandinum GN=PSBS PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 7.586e-36
Identity = 98/204 (48.04%), Postives = 109/204 (53.43%), Query Frame = 1
Query:   88 MAQTMLLMSGVSTSHAGNLKRDSLVTFQTQMLRPKPFSHLMFN--PLSNEXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXVESKPKVEDXXXXXXXXXXXXKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDEPTGLGGAVIPPGKSLRSALGLRKEVP 693
            MAQTMLL +           ++SLV    + L+PKP S L     PL                                    + K KVED            KQNELFVGRVAMIGFAASLLGE ITGKGILAQLNLETGIPIYEAEP           GAIGALGDRG+F+D+P   TGL  AVIPPGKS +SALGL +  P
Sbjct:    1 MAQTMLLTANAKVDLRS---KESLV----ERLKPKPLSSLFLPSLPLRFSSSTTNFSSSKFTSTTVALFKSKAKAPPKKVAPPKEKQKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILAQLNLETGIPIYEAEPLLLFFILFNLLGAIGALGDRGRFIDDPAPATGLEKAVIPPGKSFKSALGLSEGGP 197          

HSP 2 Score: 70.0922 bits (170), Expect = 1.303e-11
Identity = 38/75 (50.67%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  391 KQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDE 615
            K NELFVGR+A +G A S++GE ITGKG LAQLN ETG+PI E EP            AI      GKF+ + +E
Sbjct:  203 KANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIEPLLLFNIAFFFFAAINP--GTGKFITDEEE 275          
BLAST of FC869032 vs. ExPASy Swiss-Prot
Match: PSBS_ARATH (Photosystem II 22 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=PSBS PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.690e-35
Identity = 81/119 (68.07%), Postives = 88/119 (73.95%), Query Frame = 1
Query:  337 KPKVEDXXXXXXXXXXXXKQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDEPTGLGGAVIPPGKSLRSALGLRKEVP 693
            K KVED            K NELFVGRVAMIGFAASLLGE +TGKGILAQLNLETGIPIYEAEP           GAIGALGDRGKFVD+P  PTGL  AVIPPGK++RSALGL+++ P
Sbjct:   69 KSKVEDGIFGTSGGIGFTKANELFVGRVAMIGFAASLLGEALTGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDDP--PTGLEKAVIPPGKNVRSALGLKEQGP 185          

HSP 2 Score: 70.4774 bits (171), Expect = 9.977e-12
Identity = 39/75 (52.00%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  391 KQNELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGKFVDEPDE 615
            K NELFVGR+A +G A SL+GE ITGKG LAQLN+ETGIPI + EP            AI      GKF+ +  E
Sbjct:  191 KANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPIQDIEPLVLLNVAFFFFAAINP--GNGKFITDDGE 263          
The following BLAST results are available for this feature:
BLAST of FC869032 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
PSBS_SPIOL2.279e-4051.47Photosystem II 22 kDa protein, chloroplastic OS=Sp... [more]
PSBS_SOLLC2.358e-3749.51Photosystem II 22 kDa protein, chloroplastic OS=So... [more]
PSBS_TOBAC5.254e-3748.02Photosystem II 22 kDa protein, chloroplastic OS=Ni... [more]
PSBS_SOLSG7.586e-3648.04Photosystem II 22 kDa protein, chloroplastic OS=So... [more]
PSBS_ARATH1.690e-3568.07Photosystem II 22 kDa protein, chloroplastic OS=Ar... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007G08EF AbioticL1 Citrus clementina cDNA clone C31007G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869032 ID=FC869032; Name=FC869032; organism=Citrus clementina; type=EST; length=701bp
GAAAAAATCTAGTGAATCTGATCCAGTGAAACTAGCTTTGCTGGCTTGAG
AAATCTAGCAGAGTGACAACATATTCATTCAATATTAATGGCTCAAACTA
TGCTGCTCATGTCTGGGGTTTCCACTAGCCACGCAGGAAACTTGAAAAGA
GACTCTTTAGTCACATTTCAAACGCAGATGCTGAGACCTAAGCCATTCTC
TCATCTTATGTTCAACCCACTCTCTAATGAATCTTTAACTGCTGCTGCGG
CTTCTTCATCATCTAAAGCTTTTTCTACTGTTGCCCTCTTCAAATCTAAA
ACCAAAGCTCCACCCAAGACCAAGAAGGTTGAATCAAAGCCAAAAGTTGA
GGATGGTATCTTTGGGACCTCTGGAGGATTTGGTTTTACAAAGCAAAATG
AGCTCTTTGTTGGTCGTGTTGCCATGATTGGCTTTGCTGCTTCCTTGTTG
GGTGAGGGAATAACTGGGAAGGGGATTCTAGCTCAGTTGAATTTAGAGAC
CGGAATTCCAATCTATGAAGCAGAGCCACTGCTTTTATTTTTCATCCTGT
TCACCTTGCTTGGAGCAATTGGAGCTTTGGGTGACCGTGGTAAGTTCGTT
GATGAGCCAGATGAGCCCACTGGGCTCGGAGGAGCTGTCATTCCTCCAGG
CAAAAGCTTAAGATCAGCATTGGGTCTCAGGAAGGAGGTCCCATATTTGG
A
back to top