FC869105

Overview
NameFC869105
Unique NameFC869105
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12590 contig Ccv1_Contig12590:83..797. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869105 vs. ExPASy Swiss-Prot
Match: QKIL2_ARATH (KH domain-containing protein At5g56140 OS=Arabidopsis thaliana GN=At5g56140 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.496e-44
Identity = 98/162 (60.49%), Postives = 110/162 (67.90%), Query Frame = 2
Query:  236 MASSGGGRFMAYXXXXXXXXXXXXXXXXXXXXX-----ILDQEKYLSELLAERHKLNPFLPVLPNAYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADTNGLASRFQSEISGLMQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNF 706
            +   GGGRFM Y                           ++QEKYLSELLAERHKL PFLPVLP+A+RLLNQEI+RVTTLL NA+VL QSGL+H SPL SGGIF N  AD NG AS+F SE S  + SS   NWL+S GSSSGLI KRTIRVDIPV+ YPNF
Sbjct:   21 IGGGGGGRFMTYSSSLSVPPSAPQSPNYSGGLRSQSSVFVEQEKYLSELLAERHKLTPFLPVLPHAFRLLNQEILRVTTLLENATVLSQSGLDHPSPLASGGIFQNARADMNGWASQFPSERS--VPSSPGPNWLNSPGSSSGLIAKRTIRVDIPVDNYPNF 180          
BLAST of FC869105 vs. ExPASy Swiss-Prot
Match: QKIL1_ARATH (KH domain-containing protein At4g26475 OS=Arabidopsis thaliana GN=At4g26475 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.060e-41
Identity = 95/159 (59.75%), Postives = 108/159 (67.92%), Query Frame = 2
Query:  245 SGGGRFMAYXXXXXXXXXXXXXXXXXXXXX-----ILDQEKYLSELLAERHKLNPFLPVLPNAYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADTNGLASRFQSEISGLMQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNF 706
            SGGGRF+ Y                          +++QEKYLSELLAERHKL PFLPVLP+  RL+NQEI+RVTTLL NA  L QS  +H SPL SGGIF N  AD NG AS+F SE S  + SS A NWL+S GSSSGLIVKRTIRVDIPV+KYPN+
Sbjct:   20 SGGGRFVTYPPPLSVPPSAPQSPNFSGGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA--LSQSRFDHPSPLASGGIFQNSRADMNGWASQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRTIRVDIPVDKYPNY 174          
BLAST of FC869105 vs. ExPASy Swiss-Prot
Match: QKIL5_ARATH (KH domain-containing protein At1g09660 OS=Arabidopsis thaliana GN=At1g09660 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.060e-16
Identity = 53/127 (41.73%), Postives = 70/127 (55.12%), Query Frame = 2
Query:  341 DQEKYLSELLAERHKLNPFLPVLPNAYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADTNGLASRFQSEISGLMQSS-----SAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNF 706
            D+E+YL+ELL ER KL PFL V+PN  RLLN EI RV      +S       EH SP  S G  +NG  D  G +     E   L ++S     S   W+   G  +  IVK+ IR+D+PV+KYP++
Sbjct:   41 DRERYLTELLQERQKLGPFLQVMPNCCRLLNHEIRRV------SSFPDLDRYEHGSPFRSLGQPTNGKLDLEGWSMMQAEENCHLQRASPFRGPSPVGWIGMPGLPNPPIVKKVIRLDVPVDKYPSY 161          
BLAST of FC869105 vs. ExPASy Swiss-Prot
Match: QKIL3_ARATH (KH domain-containing protein At2g38610 OS=Arabidopsis thaliana GN=At2g38610 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.060e-16
Identity = 53/129 (41.09%), Postives = 71/129 (55.04%), Query Frame = 2
Query:  338 LDQEKYLSELLAERHKLNPFLPVLPNAYRLLNQEIMRVTTLLGNASVLGQSGLEH--ASPLTSGGIFSN----GGADTNGLASRFQSEISGLMQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNF 706
            +D  +YL+ELLAE  KL PF+ VLP   RLLNQE+ RV+ ++ N        L H   SP+ S  + SN    G    NGL+   Q  +SG        +W  + GS S   VKR +R++IPV+ YPNF
Sbjct:   27 IDSSQYLTELLAEHQKLTPFMQVLPICSRLLNQEMFRVSGMMSNQGFGDFDRLRHRSPSPMASSNLMSNVSNTGLGGWNGLS---QERLSG--TPGMTMDWQGAPGSPSSYTVKRILRLEIPVDNYPNF 150          
BLAST of FC869105 vs. ExPASy Swiss-Prot
Match: QKIL4_ARATH (KH domain-containing protein At3g08620 OS=Arabidopsis thaliana GN=At3g08620 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.596e-15
Identity = 49/122 (40.16%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  350 KYLSELLAERHKLNPFLPVLPNAYRLLNQEIMRVTTLLGNASVLGQSGLEH--ASPLTSGGIFSN-GGADTNGLASRFQSEISGLMQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNF 706
            +Y+S+LLAE  KL PF+ VLP   RLLNQEI R+T ++ N        L H   SP+ S  + SN  G    G        I G      A  W  +  S S   VKR +R+D+PV+ YPNF
Sbjct:   30 QYISQLLAEHQKLGPFMQVLPICSRLLNQEIFRITGMMPNQGFTDFDRLRHRSPSPMASPNLMSNVSGGGLGGWNGLPPERIGG--PHGMAMEWQGAPASPSSYPVKRILRLDLPVDTYPNF 149          
The following BLAST results are available for this feature:
BLAST of FC869105 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
QKIL2_ARATH3.496e-4460.49KH domain-containing protein At5g56140 OS=Arabidop... [more]
QKIL1_ARATH8.060e-4159.75KH domain-containing protein At4g26475 OS=Arabidop... [more]
QKIL5_ARATH1.060e-1641.73KH domain-containing protein At1g09660 OS=Arabidop... [more]
QKIL3_ARATH1.060e-1641.09KH domain-containing protein At2g38610 OS=Arabidop... [more]
QKIL4_ARATH7.596e-1540.16KH domain-containing protein At3g08620 OS=Arabidop... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31008E12EF AbioticL1 Citrus clementina cDNA clone C31008E12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869105 ID=FC869105; Name=FC869105; organism=Citrus clementina; type=EST; length=715bp
GACAGTAGGCAGCCACTAGTTTCATTAGCGAGTGTGTGTCTGGTCGGGAT
CATCCCACCAGCTACACAAATCTGCAGACAGCCGAACGCCACCTTCGTCA
TCATCAATCATCGCAATCTTCCGTCCGCCGTACGCTTCTCATCGCCGATC
GTACCGCTGAAGCCACCGCCTGGATCTGATAAAGTGACCCGACGGCGACG
ACCGTAGACACTAACAGCAGAAAACTAACTTAACGATGGCGTCATCAGGT
GGAGGCAGGTTCATGGCCTACTCGCTGTCACCTTCTGCTCCTCACTCTCC
TCACCTCCCCTCTCTCCGCTCCGCATCCTCCGCTATCCTCGATCAAGAAA
AATATCTCTCTGAGTTACTAGCTGAGCGTCATAAGCTTAATCCATTCCTG
CCTGTGTTACCGAATGCTTACCGGCTGTTGAACCAGGAAATTATGCGTGT
AACCACACTGTTGGGGAATGCATCAGTTTTAGGTCAAAGTGGGCTTGAAC
ATGCTAGCCCTCTCACCTCTGGAGGAATATTTTCAAATGGAGGAGCTGAT
ACGAATGGATTGGCATCACGGTTTCAATCAGAAATTTCTGGTTTAATGCA
GTCATCATCAGCACAAAACTGGCTTAGCTCACAAGGTAGCTCATCAGGTC
TCATTGTTAAGAGGACAATCAGAGTGGATATTCCAGTCGAAAAATATCCT
AATTTCACTTTGTCG
back to top