FC869212

Overview
NameFC869212
Unique NameFC869212
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length401
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10231 contig Ccv1_Contig10231:291..691. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: HSP7M_PHAVU (Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 5.553e-67
Identity = 123/133 (92.48%), Postives = 131/133 (98.50%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GKNPKVIENSEG+RTTPSVVAFNQKGELLVGTPAKRQA TNPTNT+FGTKRLIGR+FDDPQTQ+EM+MV +KIV+APNGDAWVEANGQQYSPSQIGAFVLTKMKETAE+YLGKSVSKAVITVPAYFNDAQRQA
Sbjct:   70 GKNPKVIENSEGARTTPSVVAFNQKGELLVGTPAKRQAVTNPTNTVFGTKRLIGRRFDDPQTQKEMKMVPFKIVKAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAEAYLGKSVSKAVITVPAYFNDAQRQA 202          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: HSP7M_PEA (Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.786e-65
Identity = 120/133 (90.23%), Postives = 129/133 (96.99%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GKNPKVIENSEG+RTTPSVVAFNQK ELLVGTPAKRQA TNPTNTLFGTKRLIGR+FDD QTQ+EM+MV YKIVRAPNGDAWVEANGQQYSPSQIGAFVLTK+KETAE+YLGK++SKAV+TVPAYFNDAQRQA
Sbjct:   71 GKNPKVIENSEGARTTPSVVAFNQKSELLVGTPAKRQAVTNPTNTLFGTKRLIGRRFDDAQTQKEMKMVPYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKIKETAEAYLGKTISKAVVTVPAYFNDAQRQA 203          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: HSP7M_SOLTU (Heat shock 70 kDa protein, mitochondrial OS=Solanum tuberosum GN=HSP68 PE=2 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 6.788e-65
Identity = 119/133 (89.47%), Postives = 128/133 (96.24%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GKNPKVIENSEG+RTTPSVVAFNQKGELLVGTPAKRQA TNPTNTL GTKRLIGR+FDDPQTQ+EM+MV YKIVR  NGDAWVEANGQQYSP+QIGAF+LTKMKETAE+YLGKS++KAVITVPAYFNDAQRQA
Sbjct:   76 GKNPKVIENSEGARTTPSVVAFNQKGELLVGTPAKRQAVTNPTNTLSGTKRLIGRRFDDPQTQKEMKMVPYKIVRGSNGDAWVEANGQQYSPTQIGAFILTKMKETAEAYLGKSINKAVITVPAYFNDAQRQA 208          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_PARL1 (Chaperone protein dnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.017e-52
Identity = 101/133 (75.94%), Postives = 112/133 (84.21%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G + KVIENSEG RTTPS+VAF Q GE LVG  AKRQA TNPTNTLF  KRLIGR +DDP TQ++  MV Y IV+APNGDAWVEA+G++YSPSQI AF+L KMKETAESYLG+ V KAVITVPAYFNDAQRQA
Sbjct:   21 GSSAKVIENSEGMRTTPSMVAFTQDGERLVGQSAKRQAVTNPTNTLFAIKRLIGRSYDDPTTQKDKGMVPYDIVKAPNGDAWVEAHGEKYSPSQISAFILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: HSP77_YEAST (Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 8.607e-52
Identity = 97/133 (72.93%), Postives = 112/133 (84.21%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK PK+IEN+EGSRTTPSVVAF ++GE LVG PAKRQA  NP NTLF TKRLIGR+F+D + QR+++ V YKIV+  NGDAWVEA GQ YSP+QIG FVL KMKETAE+YLGK V  AV+TVPAYFND+QRQA
Sbjct:   49 GKVPKIIENAEGSRTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFATKRLIGRRFEDAEVQRDIKQVPYKIVKHSNGDAWVEARGQTYSPAQIGGFVLNKMKETAEAYLGKPVKNAVVTVPAYFNDSQRQA 181          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: HSP7F_CAEEL (Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 1.124e-51
Identity = 96/133 (72.18%), Postives = 113/133 (84.96%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK PKVIEN+EG RTTPS VAF   GE LVG PAKRQA TN  NTLF TKRLIGR+++DP+ Q+++++V YKIV+A NGDAWVEA G+ YSPSQ+GAFVL KMKETAESYLG +V+ AV+TVPAYFND+QRQA
Sbjct:   50 GKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQAVTNSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWVEAQGKVYSPSQVGAFVLMKMKETAESYLGTTVNNAVVTVPAYFNDSQRQA 182          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_RHIME (Chaperone protein dnaK OS=Rhizobium meliloti GN=dnaK PE=2 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 1.917e-51
Identity = 99/133 (74.44%), Postives = 111/133 (83.46%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            GK+ KVIEN+EG+RTTPS+VAF + GE LVG PAKRQA TNP NTLF  KRLIGR F+DP TQ++  MV YKIV+A NGDAWVEA+G  YSPSQI A +L KMKETAESYLG+ V KAVITVPAYFNDAQRQA
Sbjct:   21 GKDAKVIENAEGARTTPSMVAFTEDGERLVGQPAKRQAVTNPENTLFAIKRLIGRTFEDPTTQKDKGMVPYKIVKADNGDAWVEAHGTSYSPSQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_METSB (Chaperone protein dnaK OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dnaK PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.917e-51
Identity = 96/133 (72.18%), Postives = 112/133 (84.21%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G  PKVIEN+EG+RTTPS+VAF   GE LVG PAKRQ+ TNP  T F  KRLIGR +DDP T+++M +V YKI+RA NGDAWVEA+G+QYSPSQI AF+L KMKETAE+YLG+ VS+AVITVPAYFNDAQRQA
Sbjct:   21 GTTPKVIENAEGARTTPSIVAFTDDGERLVGQPAKRQSVTNPERTFFAIKRLIGRTYDDPMTKKDMGLVPYKIIRASNGDAWVEADGKQYSPSQISAFILQKMKETAEAYLGQPVSQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_SPHWW (Chaperone protein dnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 4.271e-51
Identity = 94/133 (70.68%), Postives = 113/133 (84.96%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G  PKVIEN+EG+RTTPS+VAF + GE L+G PAKRQA TNP NT+F  KRLIGR+FDDP T+++ ++V Y IV+ PNGDAWV+A G+ YSPSQI AF L KMKETAESYLG++V++AVITVPAYFNDAQRQA
Sbjct:   21 GGKPKVIENAEGARTTPSIVAFAKDGERLIGQPAKRQAVTNPDNTIFAVKRLIGRRFDDPITRKDTELVPYHIVKGPNGDAWVQAGGEDYSPSQISAFTLQKMKETAESYLGETVTQAVITVPAYFNDAQRQA 153          
BLAST of FC869212 vs. ExPASy Swiss-Prot
Match: DNAK_NOVAD (Chaperone protein dnaK OS=Novosphingobium aromaticivorans (strain DSM 12444) GN=dnaK PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 5.579e-51
Identity = 94/133 (70.68%), Postives = 111/133 (83.46%), Query Frame = 2
Query:    2 GKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAATNPTNTLFGTKRLIGRKFDDPQTQREMQMVSYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQA 400
            G  PKVIENSEG+RTTPS+VAF + GE L+G PAKRQA TNP NT+F  KRLIGR+FDDP TQ++ ++V Y I +  NGDAWV+A GQ YSPSQI AF L KMKETAE+YLG++V++AVITVPAYFNDAQRQA
Sbjct:   21 GGTPKVIENSEGARTTPSIVAFTKDGERLIGQPAKRQAVTNPDNTIFAVKRLIGRRFDDPMTQKDTELVPYTITKGKNGDAWVKAGGQDYSPSQISAFTLQKMKETAEAYLGETVTQAVITVPAYFNDAQRQA 153          
The following BLAST results are available for this feature:
BLAST of FC869212 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7M_PHAVU5.553e-6792.48Heat shock 70 kDa protein, mitochondrial OS=Phaseo... [more]
HSP7M_PEA1.786e-6590.23Heat shock 70 kDa protein, mitochondrial OS=Pisum ... [more]
HSP7M_SOLTU6.788e-6589.47Heat shock 70 kDa protein, mitochondrial OS=Solanu... [more]
DNAK_PARL11.017e-5275.94Chaperone protein dnaK OS=Parvibaculum lavamentivo... [more]
HSP77_YEAST8.607e-5272.93Heat shock protein SSC1, mitochondrial OS=Saccharo... [more]
HSP7F_CAEEL1.124e-5172.18Heat shock 70 kDa protein F, mitochondrial OS=Caen... [more]
DNAK_RHIME1.917e-5174.44Chaperone protein dnaK OS=Rhizobium meliloti GN=dn... [more]
DNAK_METSB1.917e-5172.18Chaperone protein dnaK OS=Methylocella silvestris ... [more]
DNAK_SPHWW4.271e-5170.68Chaperone protein dnaK OS=Sphingomonas wittichii (... [more]
DNAK_NOVAD5.579e-5170.68Chaperone protein dnaK OS=Novosphingobium aromatic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31009G02EF AbioticL1 Citrus clementina cDNA clone C31009G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869212 ID=FC869212; Name=FC869212; organism=Citrus clementina; type=EST; length=401bp
GGGAAAGAACCCCAAAGTTATTGAGAACTCCGAAGGATCTAGGACTACAC
CATCAGTTGTAGCTTTCAATCAGAAGGGAGAGCTACTTGTGGGTACACCA
GCAAAGCGTCAGGCTGCGACCAACCCGACTAACACGCTCTTTGGCACCAA
GCGTTTAATTGGTAGAAAATTTGATGATCCCCAGACGCAAAGAGAAATGC
AGATGGTTTCATATAAGATAGTAAGGGCCCCCAATGGGGATGCTTGGGTT
GAAGCCAATGGGCAGCAGTACTCGCCAAGTCAGATTGGGGCCTTTGTTCT
GACCAAGATGAAAGAAACTGCAGAATCCTACCTTGGAAAGTCAGTTTCAA
AAGCAGTAATCACAGTTCCAGCTTATTTCAACGATGCTCAAAGGCAAGCT
A
back to top