FC869304

Overview
NameFC869304
Unique NameFC869304
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length153
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:329..481. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869304 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 1.999e-19
Identity = 48/50 (96.00%), Postives = 48/50 (96.00%), Query Frame = 2
Query:    2 NATCGKRLASIGL*NTEANRQAYRTLLVTAPGLGQNISGAILFEETLYQS 151
            NATCGKRLASIGL NTEANRQAYRTLLVTAPGLGQ ISGAILFEETLYQS
Sbjct:   66 NATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQS 115          
BLAST of FC869304 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 5.815e-19
Identity = 47/50 (94.00%), Postives = 48/50 (96.00%), Query Frame = 2
Query:    2 NATCGKRLASIGL*NTEANRQAYRTLLVTAPGLGQNISGAILFEETLYQS 151
            NATCGKRLASIGL NTEANRQAYRTLLV+APGLGQ ISGAILFEETLYQS
Sbjct:   77 NATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEETLYQS 126          
BLAST of FC869304 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 92.0485 bits (227), Expect = 9.919e-19
Identity = 45/50 (90.00%), Postives = 48/50 (96.00%), Query Frame = 2
Query:    2 NATCGKRLASIGL*NTEANRQAYRTLLVTAPGLGQNISGAILFEETLYQS 151
            NATCGKRLASIGL NTEANRQAYRTLL++APGLGQ +SGAILFEETLYQS
Sbjct:   74 NATCGKRLASIGLENTEANRQAYRTLLISAPGLGQYVSGAILFEETLYQS 123          
BLAST of FC869304 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.097e-17
Identity = 44/50 (88.00%), Postives = 47/50 (94.00%), Query Frame = 2
Query:    2 NATCGKRLASIGL*NTEANRQAYRTLLVTAPGLGQNISGAILFEETLYQS 151
            NATCGKRL SIGL NTEANRQA+RTLLV+APGLGQ +SGAILFEETLYQS
Sbjct:   76 NATCGKRLDSIGLENTEANRQAFRTLLVSAPGLGQYVSGAILFEETLYQS 125          
BLAST of FC869304 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.213e-16
Identity = 43/50 (86.00%), Postives = 45/50 (90.00%), Query Frame = 2
Query:    2 NATCGKRLASIGL*NTEANRQAYRTLLVTAPGLGQNISGAILFEETLYQS 151
            NATCGKRL SIG+ NTE NR+AYR LLVTAPGLGQ ISGAILFEETLYQS
Sbjct:   55 NATCGKRLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQS 104          
BLAST of FC869304 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.213e-16
Identity = 43/50 (86.00%), Postives = 45/50 (90.00%), Query Frame = 2
Query:    2 NATCGKRLASIGL*NTEANRQAYRTLLVTAPGLGQNISGAILFEETLYQS 151
            NATCGKRLASIGL NTE NRQA+RTLLVT P LG+ ISGAILFEETLYQS
Sbjct:   34 NATCGKRLASIGLENTEVNRQAWRTLLVTVPTLGEYISGAILFEETLYQS 83          
BLAST of FC869304 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 2.068e-16
Identity = 43/50 (86.00%), Postives = 45/50 (90.00%), Query Frame = 2
Query:    2 NATCGKRLASIGL*NTEANRQAYRTLLVTAPGLGQNISGAILFEETLYQS 151
            NATCGKRL SIGL NTEANRQA+RTLLVT P LG+ ISGAILFEETLYQS
Sbjct:   28 NATCGKRLDSIGLENTEANRQAWRTLLVTVPTLGEYISGAILFEETLYQS 77          
BLAST of FC869304 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.701e-16
Identity = 42/50 (84.00%), Postives = 44/50 (88.00%), Query Frame = 2
Query:    2 NATCGKRLASIGL*NTEANRQAYRTLLVTAPGLGQNISGAILFEETLYQS 151
            NATCGKRLASIGL NTE NRQAYR LL+T PGLG  ISG+ILFEETLYQS
Sbjct:   69 NATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLGDYISGSILFEETLYQS 118          
The following BLAST results are available for this feature:
BLAST of FC869304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
ALFC_ORYSJ1.999e-1996.00Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALFC1_ARATH5.815e-1994.00Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALFC_SPIOL9.919e-1990.00Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALFC2_ARATH1.097e-1788.00Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALFC_CHLRE1.213e-1686.00Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALFC1_PEA1.213e-1686.00Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALFC2_PEA2.068e-1686.00Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALFC3_ARATH2.701e-1684.00Probable fructose-bisphosphate aldolase 3, chlorop... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31010G05EF AbioticL1 Citrus clementina cDNA clone C31010G05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869304 ID=FC869304|Name=FC869304|organism=Citrus clementina|type=EST|length=153bp
AAATGCAACTTGTGGAAAACGCCTTGCCTCAATTGGGTTATAGAACACTG
AGGCTAACCGCCAGGCATACCGTACCCTCCTTGTTACAGCCCCAGGTCTT
GGACAGAACATCTCTGGTGCCATCCTTTTTGAGGAGACTCTCTACCAATC
CAC
back to top