FC869314

Overview
NameFC869314
Unique NameFC869314
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length666
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10938 contig Ccv1_Contig10938:3..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869314 vs. ExPASy Swiss-Prot
Match: KTI12_DANRE (Protein KTI12 homolog OS=Danio rerio GN=kti12 PE=2 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 4.027e-13
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  428 YCVLYCDLEEDHCRKWNKERHEKGEAAYDDKIFEDLVRRFEKPDRRNRWDSPLFEL 595
            +C++Y     D   +WNK+R  + ++ Y  +I + L+ RFE PD RNRWDSPLF +
Sbjct:  102 HCLVYSLTSADLSSEWNKDR--EADSQYTQEILDALILRFEAPDSRNRWDSPLFTI 155          

HSP 2 Score: 40.0466 bits (92), Expect = 4.027e-13
Identity = 23/64 (35.94%), Postives = 31/64 (48.44%), Query Frame = 1
Query:  229 MALVVICGQPSSGKSLAATCXXXXXXXXXXXXTVRIIDEASFHLDRNQSYASMPAEKNLRGVLR 420
            M L+++CG P SGK+  A               V I+ +    +D+N  YA    EKNLRG LR
Sbjct:    1 MPLILMCGYPCSGKTRRAQ-ELRDYFTQNTGRKVHIVGDEDQGIDKNSVYADSQKEKNLRGALR 63          
BLAST of FC869314 vs. ExPASy Swiss-Prot
Match: KTI12_XENLA (Protein KTI12 homolog OS=Xenopus laevis GN=kti12 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 6.794e-13
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  428 YCVLYCDLEEDHCRKWNKERHEKGEAAYDDKIFEDLVRRFEKPDRRNRWDSPLFEL 595
            +C+++C    +    WN+ R +  +  Y+ +IF+ LV+RFE PD RNRWDSPLF +
Sbjct:  101 HCLIHCITSPEVSSTWNQHRDKNEQ--YNQEIFDSLVQRFEFPDSRNRWDSPLFSV 154          

HSP 2 Score: 37.7354 bits (86), Expect = 6.794e-13
Identity = 24/64 (37.50%), Postives = 31/64 (48.44%), Query Frame = 1
Query:  229 MALVVICGQPSSGKSLAATCXXXXXXXXXXXXTVRIIDEASFHLDRNQSYASMPAEKNLRGVLR 420
            M L+++CG P SGKS  +               V II +    +DRN  YA    EK+LRG LR
Sbjct:    1 MPLILLCGFPCSGKS--SRSQELQEHLEQSGRKVHIIGDHVLGVDRNAVYADSREEKDLRGSLR 62          
The following BLAST results are available for this feature:
BLAST of FC869314 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
KTI12_DANRE4.027e-1342.86Protein KTI12 homolog OS=Danio rerio GN=kti12 PE=2... [more]
KTI12_XENLA6.794e-1342.86Protein KTI12 homolog OS=Xenopus laevis GN=kti12 P... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31010H07EF AbioticL1 Citrus clementina cDNA clone C31010H07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869314 ID=FC869314; Name=FC869314; organism=Citrus clementina; type=EST; length=666bp
TTCTCTTTCTTTACTTCTTTGTATTGTGAAAGAGAGATTTTCCACAATTC
ACTCGCACACACCCACGCCCACGCTGCCGCCGCTCTCACTTTCGTTCAAG
TGTGCCAGCGCTGCAGCTTCTAGCCGTTCTCGATTTGCTTCCTCGTTCCA
GTTGCTGCCGCCTCTGCGGTCGCTGCCTCCGGCTTCGTTCGCTGCCGTCA
GCGCCATAAGGGCCAACTGTTTTGACTGATGGCATTGGTTGTAATCTGTG
GGCAACCGAGCAGTGGAAAGTCACTGGCAGCAACATGTCTAGCTGAAGCT
CTAAAAGAATCAGAGGCAAAAGAGACTGTCAGGATTATTGATGAAGCTTC
TTTTCATCTTGATCGCAATCAGAGCTATGCCAGTATGCCTGCAGAGAAGA
ATTTGCGTGGAGTTCTCAGGGATTAGATACTGTGTTCTGTATTGCGACTT
GGAAGAAGATCATTGTAGAAAATGGAATAAAGAGCGCCATGAGAAAGGAG
AAGCCGCTTATGATGATAAGATATTTGAAGATTTGGTAAGAAGGTTCGAG
AAGCCAGATAGAAGAAATCGGTGGGATTCCCCTTTGTTTGAACTGTGCCC
ATATAAAGATGGAATAGAAAATTCTTCCGCCGCCATTTTGGACGCCGNTG
CTTATCTAACCAAAAA
back to top