FC872319
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC872319 vs. ExPASy Swiss-Prot
Match: IFRH_SOLTU (Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 1.134e-14 Identity = 35/46 (76.09%), Postives = 42/46 (91.30%), Query Frame = 1 Query: 7 LSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 144 LSI H+AFVKGD TNF+IEPSFGVEAS++YPDVKYT +DE L+Q+V Sbjct: 263 LSIYHTAFVKGDHTNFEIEPSFGVEASEVYPDVKYTPIDEILNQYV 308
BLAST of FC872319 vs. ExPASy Swiss-Prot
Match: IFRH_MAIZE (Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.792e-13 Identity = 32/47 (68.09%), Postives = 44/47 (93.62%), Query Frame = 1 Query: 4 ILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 144 IL+I H+AFV+G+QT F+I+P+ GV+AS+LYPDVKYTTVDEYL++F+ Sbjct: 263 ILAIGHAAFVRGEQTGFEIDPAKGVDASELYPDVKYTTVDEYLNRFL 309
BLAST of FC872319 vs. ExPASy Swiss-Prot
Match: IFRH_ARATH (Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 6.221e-13 Identity = 35/46 (76.09%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 4 ILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQF 141 +LSI H+ FV GD TN IEPSFGVEAS+LYPDVKYT+VDEYLS F Sbjct: 265 VLSINHAVFVNGD-TNISIEPSFGVEASELYPDVKYTSVDEYLSYF 309 The following BLAST results are available for this feature:
BLAST of FC872319 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC872319 ID=FC872319; Name=FC872319; organism=Citrus clementina; type=EST; length=375bpback to top |