FC872955

Overview
NameFC872955
Unique NameFC872955
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length742
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig146 contig Ccv1_Contig146:44..785. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC872955 vs. ExPASy Swiss-Prot
Match: SDL5A_SOYBN (Dynamin-related protein 5A OS=Glycine max PE=2 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 2.903e-121
Identity = 216/237 (91.14%), Postives = 230/237 (97.05%), Query Frame = 2
Query:    2 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSVVTIRGPAEAAVDAVHALLKELVHKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAWSK 712
            RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESS++TIRGPAEAAVDAVH+LLK+LVHKAISET +LKQYP LR EVG AA++SLERMRD SK+ATLQLVDMEC YLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTT+LSYVNMVCA+LRNSIPKSIVYCQVREAKRSLLDHFFTELGK+E KRLS+LLNEDPA+MERRSALAKRLELYRSAQ+EIDAVAWSK
Sbjct:  374 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSLITIRGPAEAAVDAVHSLLKDLVHKAISETLDLKQYPGLRVEVGAAAVDSLERMRDESKRATLQLVDMECGYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTILSYVNMVCATLRNSIPKSIVYCQVREAKRSLLDHFFTELGKMETKRLSSLLNEDPAIMERRSALAKRLELYRSAQAEIDAVAWSK 610          
BLAST of FC872955 vs. ExPASy Swiss-Prot
Match: SDLCA_SOYBN (Dynamin-related protein 12A OS=Glycine max PE=1 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.761e-118
Identity = 211/237 (89.03%), Postives = 229/237 (96.62%), Query Frame = 2
Query:    2 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSVVTIRGPAEAAVDAVHALLKELVHKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAWSK 712
            RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESS++TIRGPAE+AVDAVH+LLK+LVHKA+SET +LKQYP LR EVG A+++SLERMRD SK+ATLQLVDMEC YLTVDFFRKLPQDVDKGGNPTHSI DRYNDSYLRRIGTT+LSYVNMVCA+LR+SIPKSIVYCQVREAKRSLLDHFFTELGK+E KRLS+LLNEDPA+MERRSALAKRLELYRSAQ+EIDAVAWSK
Sbjct:  374 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSLITIRGPAESAVDAVHSLLKDLVHKAMSETLDLKQYPGLRVEVGAASVDSLERMRDESKRATLQLVDMECGYLTVDFFRKLPQDVDKGGNPTHSICDRYNDSYLRRIGTTILSYVNMVCATLRHSIPKSIVYCQVREAKRSLLDHFFTELGKMEIKRLSSLLNEDPAIMERRSALAKRLELYRSAQAEIDAVAWSK 610          
BLAST of FC872955 vs. ExPASy Swiss-Prot
Match: DRP1A_ARATH (Dynamin-related protein 1A OS=Arabidopsis thaliana GN=DRP1A PE=1 SV=3)

HSP 1 Score: 417.542 bits (1072), Expect = 3.672e-116
Identity = 204/237 (86.08%), Postives = 227/237 (95.78%), Query Frame = 2
Query:    2 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSVVTIRGPAEAAVDAVHALLKELVHKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAWSK 712
            RLQFDKQL+M+NIRKL+TEADGYQPHLIAPEQGYRRLIESS+V+IRGPAEA+VD VHA+LK+LVHK+++ET ELKQYPALR EV NAAIESL++MR+ SKKATLQLVDMECSYLTVDFFRKLPQDV+KGGNPTHSIFDRYNDSYLRRIG+ VLSYVNMVCA LRNSIPKSIVYCQVREAKRSLLDHFF ELG ++ KRLS+LLNEDPA+MERRSA++KRLELYR+AQSEIDAVAWSK
Sbjct:  374 RLQFDKQLAMDNIRKLVTEADGYQPHLIAPEQGYRRLIESSIVSIRGPAEASVDTVHAILKDLVHKSVNETVELKQYPALRVEVTNAAIESLDKMREGSKKATLQLVDMECSYLTVDFFRKLPQDVEKGGNPTHSIFDRYNDSYLRRIGSNVLSYVNMVCAGLRNSIPKSIVYCQVREAKRSLLDHFFAELGTMDMKRLSSLLNEDPAIMERRSAISKRLELYRAAQSEIDAVAWSK 610          
BLAST of FC872955 vs. ExPASy Swiss-Prot
Match: DRP1B_ARATH (Dynamin-related protein 1B OS=Arabidopsis thaliana GN=DRP1B PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.638e-106
Identity = 188/237 (79.32%), Postives = 216/237 (91.14%), Query Frame = 2
Query:    2 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSVVTIRGPAEAAVDAVHALLKELVHKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAWSK 712
            RLQFDK LSM+N+RKLITEADGYQPHLIAPEQGYRRLIES +V+IRGPAEAAVDAVH++LK+L+HK++ ET ELKQYP LR EV  AA++SL+RMRD S+KATL LVDME  YLTV+FFRKLPQD +KGGNPTHSIFDRYND+YLRRIG+ VLSYVNMVCA LRNSIPKSIVYCQVREAKRSLLD FFTELG+ E  +LS LL+EDPAV +RR+++AKRLELYRSAQ++I+AVAWSK
Sbjct:  374 RLQFDKHLSMDNVRKLITEADGYQPHLIAPEQGYRRLIESCLVSIRGPAEAAVDAVHSILKDLIHKSMGETSELKQYPTLRVEVSGAAVDSLDRMRDESRKATLLLVDMESGYLTVEFFRKLPQDSEKGGNPTHSIFDRYNDAYLRRIGSNVLSYVNMVCAGLRNSIPKSIVYCQVREAKRSLLDIFFTELGQKEMSKLSKLLDEDPAVQQRRTSIAKRLELYRSAQTDIEAVAWSK 610          
BLAST of FC872955 vs. ExPASy Swiss-Prot
Match: DRP1C_ARATH (Dynamin-related protein 1C OS=Arabidopsis thaliana GN=DRP1C PE=1 SV=2)

HSP 1 Score: 285.419 bits (729), Expect = 2.178e-76
Identity = 140/239 (58.58%), Postives = 191/239 (79.92%), Query Frame = 2
Query:    2 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSVVTIRGPAEAAVDAVHALLKELVHKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDK-GGNPTHS---IFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAW 706
            +L FD+ LS +N++K+++EADGYQPHLIAPEQGYRRLI+ S+   +GPAEA VDAVH +LKELV K+ISET ELK++P L +++  AA E+LER RD S+K  L+LVDME SYLTV+FFRKL  + +K   NP ++     D Y+D++ R+IG+ V +Y+NMVC +LRNS+PK++VYCQVREAKRSLL+ F+ ++G+ E+++L  +L+EDP +MERR  LAKRLELY+ A+ +IDAVAW
Sbjct:  375 KLPFDRHLSTKNVQKVVSEADGYQPHLIAPEQGYRRLIDGSISYFKGPAEATVDAVHFVLKELVRKSISETEELKRFPTLASDIAAAANEALERFRDESRKTVLRLVDMESSYLTVEFFRKLHLEPEKEKPNPRNAPAPNADPYSDNHFRKIGSNVSAYINMVCDTLRNSLPKAVVYCQVREAKRSLLNFFYAQVGRKEKEKLGAMLDEDPQLMERRGTLAKRLELYKQARDDIDAVAW 613          
BLAST of FC872955 vs. ExPASy Swiss-Prot
Match: DRP1E_ARATH (Dynamin-related protein 1E OS=Arabidopsis thaliana GN=DRP1E PE=1 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 2.408e-75
Identity = 136/243 (55.97%), Postives = 191/243 (78.60%), Query Frame = 2
Query:    2 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSVVTIRGPAEAAVDAVHALLKELVHKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDK--------GGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAW 706
            +L FD+ LS+++++K+++EADGYQPHLIAPEQGYRRLIE ++   RGPAEA+VDAVH +LKELV K+ISET ELK++P+L+ E+  AA  SLE+ R+ SKK+ ++LVDME +YLT +FFRKLPQ++++          +P+ +  D+Y D + RRI + V +YVNMV  +LRN+IPK+ VYCQVR+AK +LL++F++++ K E K+L  LL+EDPA+M+RR   AKRLELY+ A+ EIDAVAW
Sbjct:  380 KLPFDRHLSLQSVKKIVSEADGYQPHLIAPEQGYRRLIEGALGYFRGPAEASVDAVHYVLKELVRKSISETEELKRFPSLQVELAAAANSSLEKFREESKKSVIRLVDMESAYLTAEFFRKLPQEIERPVTNSKNQTASPSSATLDQYGDGHFRRIASNVSAYVNMVSDTLRNTIPKACVYCQVRQAKLALLNYFYSQISKREGKQLGQLLDEDPALMDRRLECAKRLELYKKARDEIDAVAW 622          
BLAST of FC872955 vs. ExPASy Swiss-Prot
Match: DRP1D_ARATH (Dynamin-related protein 1D OS=Arabidopsis thaliana GN=DRP1D PE=2 SV=2)

HSP 1 Score: 257.684 bits (657), Expect = 4.863e-68
Identity = 127/237 (53.59%), Postives = 182/237 (76.79%), Query Frame = 2
Query:    2 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSVVTIRGPAEAAVDAVHALLKELVHKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKG--GNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAW 706
            +L FD+ LS+++++++++E+DGYQPHLIAPE GYRRLIE S+   RGPAEA+V+A+H +LKELV KAI+ET ELK++P+L+ E+  AA  SL++ R+ S K+ L+LVDME SYLTVDFFRKL  +       +PT +I D+Y D + R+I + V +Y+ MV  +L N+IPK++V+CQVR+AK SLL++F+ ++ + + KRL  LL+E+PA+MERR   AKRLELY+ A+ EIDA  W
Sbjct:  375 KLPFDRHLSLQSVKRIVSESDGYQPHLIAPELGYRRLIEGSLNHFRGPAEASVNAIHLILKELVRKAIAETEELKRFPSLQIELVAAANSSLDKFREESMKSVLRLVDMESSYLTVDFFRKLHVESQNMSLSSPTSAI-DQYGDGHFRKIASNVAAYIKMVAETLVNTIPKAVVHCQVRQAKLSLLNYFYAQISQSQGKRLGQLLDENPALMERRMQCAKRLELYKKARDEIDAAVW 610          
BLAST of FC872955 vs. ExPASy Swiss-Prot
Match: DRP2B_ARATH (Dynamin-2B OS=Arabidopsis thaliana GN=DRP2B PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 9.301e-19
Identity = 45/124 (36.29%), Postives = 77/124 (62.10%), Query Frame = 2
Query:    2 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSVVTIRGPAEAAVDAVHALLKELVHKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQ 373
            +L  D+   + N+++++ EADGYQP+LI+PE+G R LI++ +   + PA   VD VH +L ++V  + + TP L +YP  + EV   A  +L+  ++ +KK  + LVDME +++    F +L Q
Sbjct:  377 KLPLDRHFDLNNVKRIVLEADGYQPYLISPEKGLRSLIKTVLELAKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKMVVALVDMERAFVPPQHFIRLVQ 500          
BLAST of FC872955 vs. ExPASy Swiss-Prot
Match: DRP2A_ARATH (Dynamin-2A OS=Arabidopsis thaliana GN=DRP2A PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 3.534e-18
Identity = 45/124 (36.29%), Postives = 76/124 (61.29%), Query Frame = 2
Query:    2 RLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSVVTIRGPAEAAVDAVHALLKELVHKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQ 373
            +L  D+   + N+++++ EADGYQP+LI+PE+G R LI+  +   + PA   VD VH +L ++V  + + TP L +YP  + EV   A  +L+  ++ +KK  + LVDME +++    F +L Q
Sbjct:  377 QLPLDRHFDLNNVKRVVLEADGYQPYLISPEKGLRSLIKIVLELAKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKMVVALVDMERAFVPPQHFIRLVQ 500          
The following BLAST results are available for this feature:
BLAST of FC872955 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
SDL5A_SOYBN2.903e-12191.14Dynamin-related protein 5A OS=Glycine max PE=2 SV=... [more]
SDLCA_SOYBN1.761e-11889.03Dynamin-related protein 12A OS=Glycine max PE=1 SV... [more]
DRP1A_ARATH3.672e-11686.08Dynamin-related protein 1A OS=Arabidopsis thaliana... [more]
DRP1B_ARATH2.638e-10679.32Dynamin-related protein 1B OS=Arabidopsis thaliana... [more]
DRP1C_ARATH2.178e-7658.58Dynamin-related protein 1C OS=Arabidopsis thaliana... [more]
DRP1E_ARATH2.408e-7555.97Dynamin-related protein 1E OS=Arabidopsis thaliana... [more]
DRP1D_ARATH4.863e-6853.59Dynamin-related protein 1D OS=Arabidopsis thaliana... [more]
DRP2B_ARATH9.301e-1936.29Dynamin-2B OS=Arabidopsis thaliana GN=DRP2B PE=1 S... [more]
DRP2A_ARATH3.534e-1836.29Dynamin-2A OS=Arabidopsis thaliana GN=DRP2A PE=1 S... [more]
back to top
Libraries
Library NameType
AbsDevcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAI3DG07FM1 AbsDev Citrus clementina cDNA clone KN0AAI3DG07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC872955 ID=FC872955|Name=FC872955|organism=Citrus clementina|type=EST|length=742bp
AAGGTTGCAATTTGACAAGCAACTCTCCATGGAAAATATTCGGAAGCTCA
TTACTGAAGCTGATGGATATCAGCCTCATTTGATTGCCCCTGAACAAGGA
TACCGTCGTTTGATAGAATCATCTGTGGTTACCATCAGAGGTCCTGCTGA
GGCAGCTGTTGATGCGGTTCATGCTTTACTGAAGGAACTGGTTCACAAGG
CCATCAGTGAAACCCCTGAATTAAAGCAGTATCCTGCTCTCCGAGCAGAA
GTTGGAAATGCAGCTATCGAGTCTCTTGAGAGAATGAGGGACACAAGCAA
AAAAGCTACACTTCAGCTTGTTGATATGGAGTGCAGTTATCTGACAGTTG
ATTTCTTCCGGAAGCTTCCTCAGGATGTTGACAAGGGTGGCAATCCTACA
CATTCAATTTTTGACAGATACAATGATTCGTATCTAAGGAGAATTGGAAC
CACGGTCTTGTCTTATGTCAATATGGTCTGTGCAAGTCTGCGGAACTCAA
TTCCTAAGTCCATCGTTTATTGTCAAGTTCGTGAGGCCAAACGAAGCCTA
CTTGATCATTTCTTCACTGAATTGGGTAAATTGGAGCAAAAACGATTGTC
AAACCTGTTGAATGAAGATCCGGCAGTCATGGAGCGACGATCTGCCCTTG
CAAAAAGGTTGGAGTTATACAGGAGTGCACAATCAGAAATTGATGCAGTT
GCTTGGTCAAAGTAGTTCAACATTTTACCAGTCCATTTCAGC
back to top