FC875271

Overview
NameFC875271
Unique NameFC875271
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length665
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10194 contig Ccv1_Contig10194:1..665. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS263_ARATH (40S ribosomal protein S26-3 OS=Arabidopsis thaliana GN=RPS26C PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 9.550e-30
Identity = 62/82 (75.61%), Postives = 65/82 (79.27%), Query Frame = 1
Query:   61 MTFXXXXXXXXXXXXXXVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 306
            MTF              VK IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    1 MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS262_ARATH (40S ribosomal protein S26-2 OS=Arabidopsis thaliana GN=RPS26B PE=2 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 3.629e-29
Identity = 61/82 (74.39%), Postives = 64/82 (78.05%), Query Frame = 1
Query:   61 MTFXXXXXXXXXXXXXXVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 306
            MTF              V  IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS261_ARATH (40S ribosomal protein S26-1 OS=Arabidopsis thaliana GN=RPS26A PE=2 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 3.629e-29
Identity = 61/82 (74.39%), Postives = 64/82 (78.05%), Query Frame = 1
Query:   61 MTFXXXXXXXXXXXXXXVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 306
            MTF              V  IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_ORYSJ (40S ribosomal protein S26 OS=Oryza sativa subsp. japonica GN=RPS26 PE=2 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 1.379e-28
Identity = 58/82 (70.73%), Postives = 64/82 (78.05%), Query Frame = 1
Query:   61 MTFXXXXXXXXXXXXXXVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 306
            MTF              VK+IRCSNC KCCPKDKAIKRF VRNIVEQAA+RDVQEACV+DGY LPKLYAK+ +CVSCAIH+H
Sbjct:    1 MTFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHDGYVLPKLYAKVHHCVSCAIHAH 82          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_OCTVU (40S ribosomal protein S26 OS=Octopus vulgaris GN=RPS26 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.477e-22
Identity = 46/64 (71.88%), Postives = 56/64 (87.50%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            VK+IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ +A VY+ Y LPKLYAK+ YCVSCAIHS
Sbjct:   18 VKYIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYEVYALPKLYAKLLYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_CAEEL (40S ribosomal protein S26 OS=Caenorhabditis elegans GN=rps-26 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.477e-22
Identity = 48/81 (59.26%), Postives = 57/81 (70.37%), Query Frame = 1
Query:   61 MTFXXXXXXXXXXXXXXVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            MTF              V FIRC+NCG+CCPKDKAIK+F+VRNIVE AAVRD+ +A  Y  Y LPKLY K+ YC++CAIHS
Sbjct:    1 MTFKRRNHGRNKKNRGHVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_DROME (40S ribosomal protein S26 OS=Drosophila melanogaster GN=RpS26 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.290e-22
Identity = 45/64 (70.31%), Postives = 55/64 (85.94%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            VK +RC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA ++D Y LPKLYAK+ YCVSCAIHS
Sbjct:   18 VKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_ANOGA (40S ribosomal protein S26 OS=Anopheles gambiae GN=RpS26 PE=3 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 3.290e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            VK +RC+NC +C PKDKAIK+F++RNIVE AAVRD+ +A VY  Y LPKLYAK+ YCVSCAIHS
Sbjct:   18 VKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYSSYVLPKLYAKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_RAT (40S ribosomal protein S26 OS=Rattus norvegicus GN=Rps26 PE=3 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 9.572e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHS 81          
BLAST of FC875271 vs. ExPASy Swiss-Prot
Match: RS26_PIG (40S ribosomal protein S26 OS=Sus scrofa GN=RPS26 PE=3 SV=4)

HSP 1 Score: 103.605 bits (257), Expect = 9.572e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  112 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 303
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHS 81          
The following BLAST results are available for this feature:
BLAST of FC875271 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
RS263_ARATH9.550e-3075.6140S ribosomal protein S26-3 OS=Arabidopsis thalian... [more]
RS262_ARATH3.629e-2974.3940S ribosomal protein S26-2 OS=Arabidopsis thalian... [more]
RS261_ARATH3.629e-2974.3940S ribosomal protein S26-1 OS=Arabidopsis thalian... [more]
RS26_ORYSJ1.379e-2870.7340S ribosomal protein S26 OS=Oryza sativa subsp. j... [more]
RS26_OCTVU1.477e-2271.8840S ribosomal protein S26 OS=Octopus vulgaris GN=R... [more]
RS26_CAEEL1.477e-2259.2640S ribosomal protein S26 OS=Caenorhabditis elegan... [more]
RS26_DROME3.290e-2270.3140S ribosomal protein S26 OS=Drosophila melanogast... [more]
RS26_ANOGA3.290e-2270.3140S ribosomal protein S26 OS=Anopheles gambiae GN=... [more]
RS26_RAT9.572e-2270.3140S ribosomal protein S26 OS=Rattus norvegicus GN=... [more]
RS26_PIG9.572e-2270.3140S ribosomal protein S26 OS=Sus scrofa GN=RPS26 P... [more]

Pages

back to top
Libraries
Library NameType
CTVClemen1cdna_library
Properties
Property NameValue
Genbank descriptionC31402B03EF CTVClemen1 Citrus clementina cDNA clone C31402B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875271 ID=FC875271|Name=FC875271|organism=Citrus clementina|type=EST|length=665bp
GGAACAACCCTGACCCTCTGAAACAACAAGCAGCAGCGGCGCAACAAAAA
CAACAACAAGATGACGTTCAAGCGGAGGAACGGAGGAAGGAACAAGCACG
GCCGTGGCCACGTCAAGTTCATCCGCTGCTCTAACTGCGGCAAATGCTGC
CCTAAGGACAAGGCGATTAAGAGGTTTTTGGTGAGGAACATTGTTGAGCA
AGCTGCTGTTAGGGATGTTCAGGAGGCGTGTGTTTATGACGGTTACACTC
TTCCTAAGTTATATGCTAAGATGCAGTACTGCGTCTCGTGTGCGATCCAC
TCTCATGTGGTGAGAGTTCGTTCCCGTACTAACAGGAGGATCCGTGAGCC
CCCGCAACGCTTCAGGCGCAGGGATGATGTCCCAAAGGCTGGTGGTGCTC
TTGGTCAAGGCCCACGAGCTGGTGGTCCAGCTGGAGCTCCAGCTGCTGCT
CGTGCTTGAAAGCTTTCTGCTGTCAGTGCTTCTGGTCCTTTGAGGCTTTT
GAGATTTTTATGTGGTGGTATCAGATATGTGGGTCTGTTTAATTAGAGCA
CTGCAAACTTTTATGTTAGTTTTGTGTTTTGTTGTCATGCATCAGAGAAC
TGTTTACTGTCAAAAGTTTGAATCAAAACCCTAGAGAATTTTGATGGAGT
GATTGAAGTAAAATT
back to top