FC876171

Overview
NameFC876171
Unique NameFC876171
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length503
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig2817 contig Ccv1_Contig2817:138..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876171 vs. ExPASy Swiss-Prot
Match: DET1_YEAST (Putative phosphoglycerate mutase DET1 OS=Saccharomyces cerevisiae GN=DET1 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.192e-13
Identity = 34/60 (56.67%), Postives = 47/60 (78.33%), Query Frame = 3
Query:  315 VREECRIREQDFGNFQVSERMKVIKETREKFGRFYYRFPEGESAADVFDRVSNFLESLWR 494
            V++E RIREQDFGNFQ    M+ + + R  +G F++RFP GESAADV+DRV++F E+L+R
Sbjct:  196 VKDEPRIREQDFGNFQKINSMQDVMKKRSTYGHFFFRFPHGESAADVYDRVASFQETLFR 255          
The following BLAST results are available for this feature:
BLAST of FC876171 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
DET1_YEAST1.192e-1356.67Putative phosphoglycerate mutase DET1 OS=Saccharom... [more]
back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001B07EF DevOvary1 Citrus clementina cDNA clone C32001B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876171 ID=FC876171|Name=FC876171|organism=Citrus clementina|type=EST|length=503bp
GGTTGCAAACAACCACCAGCGCTGCCACAGCCACCAGAGGCACCTGCTGC
CGAATCGGATCATCCTGGTCCGACACGGCGAGTCGGAGGGGAACCTCAAC
ACCGGCGCCTACGCCACCACGCCCGATAACAAGATCCCCCTGACGCCCGG
CGGAATCCACCAGGGTCGCTCTTGCGGGGCCCGCCTCCGCTCATTGCTCT
CCGGCTCCGCCAATGACTACCGCGTCTACTTCTACGTGTCGCCGTACGAG
CGAGCGCACGCGGTCGACGCTCCGCGAGATCGGACGCTCGTTCTCCAGGA
AGCGTATAATTGGCGTCAGAGAAGAGTGCAGGATTCGCGAACAGGATTTC
GGTAACTTTCAGGTGAGTGAGAGGATGAAAGTAATAAAGGAAACAAGGGA
GAAGTTTGGGAGATTTTATTATAGATTTCCTGAAGGGGAGTCGGCAGCTG
ATGTTTTTGACCGTGTTTCAAATTTTCTAGAATCCCTGTGGAGGGACATA
GAC
back to top