FC876181

Overview
NameFC876181
Unique NameFC876181
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length722
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10305 contig Ccv1_Contig10305:1..722. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR1A_ARATH (GTP-binding protein SAR1A OS=Arabidopsis thaliana GN=SAR1A PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 2.522e-74
Identity = 139/181 (76.80%), Postives = 147/181 (81.22%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLXNFTTGKGEVNLAELNVRPLEVFMCSIVRKMGY 722
            MF++DWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQ+PTSEELSIGKIKFKAFDLGGHQIARRVW                   ERFAESKK            +VPFL+LGNKIDIPYAASE+ELRYHLGL NFTTGKG+VNL + NVRPLEVFMCSIVRKMGY
Sbjct:    1 MFMIDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDESLASVPFLILGNKIDIPYAASEDELRYHLGLSNFTTGKGKVNLTDSNVRPLEVFMCSIVRKMGY 181          
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR1A_BRACM (GTP-binding protein SAR1A OS=Brassica campestris GN=SAR1A PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 4.757e-73
Identity = 138/181 (76.24%), Postives = 145/181 (80.11%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLXNFTTGKGEVNLAELNVRPLEVFMCSIVRKMGY 722
            MF++DWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQ+PTSEELSIGKIKFKAFDLGGHQIARRVW                   ERFAESKK             VPFL+LGNKIDIPYAASE+ELRYHLGL NFTTGKG+V+L   NVRPLEVFMCSIVRKMGY
Sbjct:    1 MFVIDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDESLATVPFLILGNKIDIPYAASEDELRYHLGLSNFTTGKGKVDLVGSNVRPLEVFMCSIVRKMGY 181          
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR1B_ARATH (GTP-binding protein SAR1B OS=Arabidopsis thaliana GN=SAR1B PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 2.361e-72
Identity = 136/181 (75.14%), Postives = 143/181 (79.01%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLXNFTTGKGEVNLAELNVRPLEVFMCSIVRKMGY 722
            MFL DWFYG+LASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQ+PTSEELSIGKIKFKAFDLGGHQIARRVW                   ERFAESK+             VPFL+LGNKIDIPYAASE+ELRYHLGL NFTTGKG+V L +  VRPLEVFMCSIVRKMGY
Sbjct:    1 MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGY 181          
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR2_SOLLC (GTP-binding protein SAR2 OS=Solanum lycopersicum GN=SAR2 PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 6.869e-72
Identity = 135/181 (74.59%), Postives = 142/181 (78.45%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLXNFTTGKGEVNLAELNVRPLEVFMCSIVRKMGY 722
            MFL+DWFYGVLASLGLWQK+AKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIG IKFKAFDLGGHQIARRVW                   ERF E+KK            NVPFL+LGNKIDIPYAASE+ELRYHLGL   TTGKG +NLA  NVRP+EVFMCSIVRKMGY
Sbjct:    1 MFLVDWFYGVLASLGLWQKDAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGNIKFKAFDLGGHQIARRVWRDYYAKVDAVVYLVDANDRERFPEAKKELDGLLSDESLTNVPFLILGNKIDIPYAASEDELRYHLGLTGVTTGKGNINLAGTNVRPIEVFMCSIVRKMGY 181          
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR1B_BRACM (GTP-binding protein SAR1B OS=Brassica campestris GN=SAR1B PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 6.429e-70
Identity = 135/183 (73.77%), Postives = 142/183 (77.60%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLXNFTTGKGEVNLA--ELNVRPLEVFMCSIVRKMGY 722
            MFL DWFYG+LASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQ+PTSEELSIGKIKFKAFDLGGHQIARRVW                   ERF+ESKK             VPFL+LGNKID PYAASE+ELRYHLGL NFTTGKG+V  A  +  VRPLEVFMCSIVRKMGY
Sbjct:    1 MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFSESKKELDALLSDDALATVPFLILGNKIDNPYAASEDELRYHLGLTNFTTGKGKVTTAGGDSGVRPLEVFMCSIVRKMGY 183          
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR1_TOBAC (GTP-binding protein SAR1 OS=Nicotiana tabacum GN=SAR1 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.008e-55
Identity = 117/186 (62.90%), Postives = 130/186 (69.89%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGN---KIDIPYAASEE-ELRYHLGLXNFT-TGKGEVNLAELNVRPLEVFMCSIVRKMGY 722
            MFL+DWFYG+LA+LGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVW                   ERFAESKK               FL L N   +I+ P     +   RYH+G    +   +G+VNLA+ NVRP+EVFMCSIVR+MGY
Sbjct:    1 MFLVDWFYGILATLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDSFDKERFAESKKELDALLSGWSSLAHCFLFLDNWVTRIEHPICCLRKMNWRYHMGANGASPLARGKVNLADSNVRPVEVFMCSIVRQMGY 186          
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR1_YARLI (Small COPII coat GTPase SAR1 OS=Yarrowia lipolytica GN=SAR1 PE=3 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.296e-48
Identity = 102/181 (56.35%), Postives = 120/181 (66.30%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLXNFTTGKGEVNLAELNVRPLEVFMCSIVRKMGY 722
            M++++WFY VL+SLGLW K AK+LFLGLDNAGKTTLLHMLK++R+    PT +PTSEELSIG  KF  FDLGGH  ARRVW                    RFAESK              VPFL+LGNKID+P A SE EL+  LGL   TTGKG+V L E N+RP+E+FMCSIV + GY
Sbjct:    1 MWIVNWFYDVLSSLGLWNKNAKLLFLGLDNAGKTTLLHMLKNDRMAVSNPTVHPTSEELSIGNCKFTTFDLGGHIQARRVWKDYFPEVNGIVFLVDAADPTRFAESKAELDSLLAIEQLKTVPFLILGNKIDMPQAVSELELKDALGLYQ-TTGKGKVPL-EGNIRPIEIFMCSIVMRQGY 179          
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR1_USTMA (Small COPII coat GTPase SAR1 OS=Ustilago maydis GN=SAR1 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.180e-47
Identity = 98/181 (54.14%), Postives = 123/181 (67.96%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLXNFTTGKGEVNLAELNVRPLEVFMCSIVRKMGY 722
            MF+++WF+ +LA LGL  K AKILFLGLDNAGKTTLLHMLK++RL   QPT +PTSEEL+IG++KF  +DLGGHQ ARR+W                   ERFAE++             +VPFL+LGNKID P A SEEELR  +GL   TTGKG+V L +  +RP+E+FMCS+V + GY
Sbjct:    1 MFIINWFWDILAQLGLAHKNAKILFLGLDNAGKTTLLHMLKNDRLATLQPTLHPTSEELAIGQVKFTTYDLGGHQQARRLWKDYFPEVDGIVFLVDTQDHERFAEARAELDALLSIEELSSVPFLILGNKIDAPGAVSEEELRQAIGLYQ-TTGKGKVPLKD--IRPIEIFMCSVVMRQGY 178          
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR1_NEOFI (Small COPII coat GTPase sar1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sar1 PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.433e-47
Identity = 100/181 (55.25%), Postives = 120/181 (66.30%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLXNFTTGKGEVNLAELNVRPLEVFMCSIVRKMGY 722
            M++++WFY VLASLGL  K AK+LFLGLDNAGKTTLLHMLK++R+   QPT +PTSEEL+IG  +F  FDLGGHQ ARR+W                   ERF ESK              VPFL+LGNKID P A SE+ELR+ LGL   TTGKG+V L    +RP+EVFMCS+V + GY
Sbjct:    1 MWIINWFYDVLASLGLLNKHAKLLFLGLDNAGKTTLLHMLKNDRVATLQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHERFPESKAELDALLAMEELAKVPFLILGNKIDHPDAVSEDELRHQLGLYQ-TTGKGKVPLE--GIRPIEVFMCSVVMRQGY 178          
BLAST of FC876181 vs. ExPASy Swiss-Prot
Match: SAR1_ASPCL (Small COPII coat GTPase sar1 OS=Aspergillus clavatus GN=sar1 PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.433e-47
Identity = 100/181 (55.25%), Postives = 120/181 (66.30%), Query Frame = 3
Query:  180 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWXXXXXXXXXXXXXXXXXXXERFAESKKXXXXXXXXXXXXNVPFLVLGNKIDIPYAASEEELRYHLGLXNFTTGKGEVNLAELNVRPLEVFMCSIVRKMGY 722
            M++++WFY VLASLGL  K AK+LFLGLDNAGKTTLLHMLK++R+   QPT +PTSEEL+IG  +F  FDLGGHQ ARR+W                   ERF ESK              VPFL+LGNKID P A SE+ELR+ LGL   TTGKG+V L    +RP+EVFMCS+V + GY
Sbjct:    1 MWIINWFYDVLASLGLLNKHAKLLFLGLDNAGKTTLLHMLKNDRVATLQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHERFPESKAELDALLAMEELSKVPFLILGNKIDHPDAVSEDELRHQLGLYQ-TTGKGKVPLE--GIRPIEVFMCSVVMRQGY 178          
The following BLAST results are available for this feature:
BLAST of FC876181 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
SAR1A_ARATH2.522e-7476.80GTP-binding protein SAR1A OS=Arabidopsis thaliana ... [more]
SAR1A_BRACM4.757e-7376.24GTP-binding protein SAR1A OS=Brassica campestris G... [more]
SAR1B_ARATH2.361e-7275.14GTP-binding protein SAR1B OS=Arabidopsis thaliana ... [more]
SAR2_SOLLC6.869e-7274.59GTP-binding protein SAR2 OS=Solanum lycopersicum G... [more]
SAR1B_BRACM6.429e-7073.77GTP-binding protein SAR1B OS=Brassica campestris G... [more]
SAR1_TOBAC2.008e-5562.90GTP-binding protein SAR1 OS=Nicotiana tabacum GN=S... [more]
SAR1_YARLI5.296e-4856.35Small COPII coat GTPase SAR1 OS=Yarrowia lipolytic... [more]
SAR1_USTMA1.180e-4754.14Small COPII coat GTPase SAR1 OS=Ustilago maydis GN... [more]
SAR1_NEOFI3.433e-4755.25Small COPII coat GTPase sar1 OS=Neosartorya fische... [more]
SAR1_ASPCL3.433e-4755.25Small COPII coat GTPase sar1 OS=Aspergillus clavat... [more]

Pages

back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001C09EF DevOvary1 Citrus clementina cDNA clone C32001C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876181 ID=FC876181|Name=FC876181|organism=Citrus clementina|type=EST|length=722bp
CTCGCCGGGGAAGCAGTCCCTGGTTGATTACGTTCGCCCACTGAACTTGC
TCATCTTAGGGTCAGTATCAAATCGAAACAGAGGCCTTGAATTGGACGAT
CTGATTCGTTCTCAGCCTTAGATCGTCGTAAATTCAAGCTCGATCCGTTT
TCGTTTCTAATTTGTCTACCGATAAAGCCATGTTTCTCCTCGACTGGTTC
TACGGCGTGCTGGCCTCCCTCGGTCTTTGGCAGAAAGAGGCCAAGATCTT
GTTTTTAGGGCTTGATAATGCTGGAAAAACAACGTTGCTTCACATGTTGA
AAGATGAGAGATTGGTTCAACATCAGCCAACACAGTATCCCACATCGGAA
GAGCTTAGTATTGGGAAAATTAAGTTCAAGGCGTTTGATTTGGGAGGCCA
TCAGATTGCTAGGAGAGTCTGGAAGGATTACTATGCGAAGGTTGATGCTG
TGGTATACCTAGTGGATGCCTATGACAAAGAGAGGTTTGCAGAATCAAAG
AAAGAACTGGATGCACTCCTTTCTGATGAGGCATTGGCCAATGTTCCTTT
TCTTGTGTTAGGAAACAAGATTGACATCCCTTATGCTGCTTCTGAGGAAG
AGTTGCGTTACCACCTTGGCCTATNCAATTTCACCACTGGGAAAGGGGAG
GTTAATCTAGCGGAACTCAATGTCCGTCCACTGGAGGTGTTTATGTGTAG
CATAGTTCGCAAAATGGGATAT
back to top