FC876182

Overview
NameFC876182
Unique NameFC876182
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length731
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NBP35_CRYNE (Cytosolic Fe-S cluster assembly factor NBP35 OS=Cryptococcus neoformans GN=NBP35 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.039e-24
Identity = 43/64 (67.19%), Postives = 51/64 (79.69%), Query Frame = 3
Query:  480 IPENANEHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            +PENA EHCPG +S  AG++D C+GCPNQ  CA  PKGPDPDL  I ERM++V+ KILVLSGKG
Sbjct:   27 VPENAPEHCPGVESSQAGKADACEGCPNQSVCAEGPKGPDPDLPLIRERMSSVRRKILVLSGKG 90          

HSP 2 Score: 32.7278 bits (73), Expect = 4.039e-24
Identity = 15/19 (78.95%), Postives = 18/19 (94.74%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALAA 723
            +GGVGKSTF+A LS+ALAA
Sbjct:   89 KGGVGKSTFTAGLSWALAA 107          
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NBP35_ASPTN (Cytosolic Fe-S cluster assembly factor nbp35 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nbp35 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 4.318e-23
Identity = 41/58 (70.69%), Postives = 48/58 (82.76%), Query Frame = 3
Query:  498 EHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            EHCPGP+SE AG+ D C GCPNQ  CATAPKGPDPD+  I ER++ ++HKILVLSGKG
Sbjct:   29 EHCPGPESEQAGKGDACAGCPNQNICATAPKGPDPDVAIITERLSQIRHKILVLSGKG 86          

HSP 2 Score: 30.0314 bits (66), Expect = 4.318e-23
Identity = 13/19 (68.42%), Postives = 17/19 (89.47%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALAA 723
            +GGVGKSTFS+ L++A AA
Sbjct:   85 KGGVGKSTFSSLLAHAFAA 103          
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NBP35_CHAGB (Cytosolic Fe-S cluster assembly factor NBP35 OS=Chaetomium globosum GN=NBP35 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.319e-23
Identity = 44/58 (75.86%), Postives = 48/58 (82.76%), Query Frame = 3
Query:  498 EHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            EHCPGP+SE AG +D C GCPNQ  CA+APKGPDPDL AI  R+A VKHKILVLSGKG
Sbjct:   31 EHCPGPESEQAGTADSCAGCPNQAICASAPKGPDPDLPAITARLAGVKHKILVLSGKG 88          

HSP 2 Score: 29.261 bits (64), Expect = 4.319e-23
Identity = 13/18 (72.22%), Postives = 16/18 (88.89%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALA 720
            +GGVGKST +AQL+ ALA
Sbjct:   87 KGGVGKSTLTAQLAQALA 104          
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NUBP1_DICDI (Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Dictyostelium discoideum GN=nubp1 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 9.532e-23
Identity = 42/58 (72.41%), Postives = 49/58 (84.48%), Query Frame = 3
Query:  498 EHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            E+CPG QSE +G+S  C GCPNQ+ CATAPKGPDPD++ I ERM TVK+KILVLSGKG
Sbjct:   11 ENCPGTQSEMSGKSAACAGCPNQQICATAPKGPDPDIIEIEERMKTVKNKILVLSGKG 68          

HSP 2 Score: 33.113 bits (74), Expect = 9.532e-23
Identity = 14/18 (77.78%), Postives = 18/18 (100.00%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALA 720
            +GGVGKSTFS+QLS+AL+
Sbjct:   67 KGGVGKSTFSSQLSFALS 84          
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NBP35_KLULA (Cytosolic Fe-S cluster assembly factor NBP35 OS=Kluyveromyces lactis GN=NBP35 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.730e-22
Identity = 40/64 (62.50%), Postives = 49/64 (76.56%), Query Frame = 3
Query:  480 IPENANEHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            + E   EHCPGP+SE+AG+ D CQGC N+E C + PKGPDPDL  I E +A +KHKIL+LSGKG
Sbjct:   17 LKEPEPEHCPGPESENAGKGDSCQGCANKEVCESLPKGPDPDLPLIKENLANIKHKILILSGKG 80          

HSP 2 Score: 30.8018 bits (68), Expect = 2.730e-22
Identity = 13/19 (68.42%), Postives = 17/19 (89.47%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALAA 723
            +GGVGKSTF+  LS+AL+A
Sbjct:   79 KGGVGKSTFTTMLSWALSA 97          
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NBP35_SCHPO (Cytosolic Fe-S cluster assembly factor nbp35 OS=Schizosaccharomyces pombe GN=nbp35 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.731e-22
Identity = 40/64 (62.50%), Postives = 51/64 (79.69%), Query Frame = 3
Query:  480 IPENANEHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            +P +A EHCPGP SE+AG +  C+GCPNQ+ CA+AP+G DPDL  + ER+  +KHKILVLSGKG
Sbjct:    7 VPLDAPEHCPGPSSENAGTASACEGCPNQQICASAPRGEDPDLPLVVERLKEIKHKILVLSGKG 70          

HSP 2 Score: 30.0314 bits (66), Expect = 2.731e-22
Identity = 12/18 (66.67%), Postives = 17/18 (94.44%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALA 720
            +GGVGKSTFS+QL++ L+
Sbjct:   69 KGGVGKSTFSSQLAWGLS 86          
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NBP35_ASPFU (Cytosolic Fe-S cluster assembly factor nbp35 OS=Aspergillus fumigatus GN=nbp35 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.615e-22
Identity = 40/58 (68.97%), Postives = 48/58 (82.76%), Query Frame = 3
Query:  498 EHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            EHCPGP+SE AG+ D C GCPNQ  CA+APKGPDPD+  I ER++ ++HKILVLSGKG
Sbjct:   28 EHCPGPESEQAGKGDACAGCPNQAICASAPKGPDPDIPIITERLSQIRHKILVLSGKG 85          

HSP 2 Score: 28.8758 bits (63), Expect = 4.615e-22
Identity = 12/19 (63.16%), Postives = 17/19 (89.47%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALAA 723
            +GGVGKSTFS+ L++A A+
Sbjct:   84 KGGVGKSTFSSLLAHAFAS 102          
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NBP35_ASPOR (Cytosolic Fe-S cluster assembly factor nbp35 OS=Aspergillus oryzae GN=nbp35 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.621e-22
Identity = 40/58 (68.97%), Postives = 48/58 (82.76%), Query Frame = 3
Query:  498 EHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            EHCPGP+SE AG+ D C GCPNQ+ CA+ PKGPDPD+  I ER++ V+HKILVLSGKG
Sbjct:   11 EHCPGPESEQAGQGDACAGCPNQQICASTPKGPDPDIPIIRERLSQVRHKILVLSGKG 68          

HSP 2 Score: 28.8758 bits (63), Expect = 4.621e-22
Identity = 12/19 (63.16%), Postives = 17/19 (89.47%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALAA 723
            +GGVGKSTFS+ L++A +A
Sbjct:   67 KGGVGKSTFSSLLAHAFSA 85          
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NBP35_YARLI (Cytosolic Fe-S cluster assembly factor NBP35 OS=Yarrowia lipolytica GN=NBP35 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.006e-22
Identity = 43/58 (74.14%), Postives = 49/58 (84.48%), Query Frame = 3
Query:  498 EHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            EHCPG +SE AG++D CQGCPNQ+ CA+APKGPDPDL  I +RM  VKHKILVLSGKG
Sbjct:   27 EHCPGTESEEAGKADACQGCPNQDICASAPKGPDPDLPLIKDRMKGVKHKILVLSGKG 84          

HSP 2 Score: 26.9498 bits (58), Expect = 6.006e-22
Identity = 11/19 (57.89%), Postives = 15/19 (78.95%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALAA 723
            +GGVGKSTFS+ L +  A+
Sbjct:   83 KGGVGKSTFSSLLGWGFAS 101          
BLAST of FC876182 vs. ExPASy Swiss-Prot
Match: NBP35_PHANO (Cytosolic Fe-S cluster assembly factor NBP35 OS=Phaeosphaeria nodorum GN=NBP35 PE=3 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 6.006e-22
Identity = 40/58 (68.97%), Postives = 49/58 (84.48%), Query Frame = 3
Query:  498 EHCPGPQSESAGESDDCQGCPNQEACATAPKGPDPDLVAIAERMATVKHKILVLSGKG 671
            EHCPGP+S+ AG +D+C GCPNQ  CA+APKGPDPD+  I  R+++VKHKILVLSGKG
Sbjct:   29 EHCPGPESQQAGTADNCAGCPNQAICASAPKGPDPDIPLITARLSSVKHKILVLSGKG 86          

HSP 2 Score: 28.8758 bits (63), Expect = 6.006e-22
Identity = 12/19 (63.16%), Postives = 15/19 (78.95%), Query Frame = 1
Query:  667 RGGVGKSTFSAQLSYALAA 723
            +GGVGKSTFS  LS+  +A
Sbjct:   85 KGGVGKSTFSTMLSHGFSA 103          
The following BLAST results are available for this feature:
BLAST of FC876182 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
NBP35_CRYNE4.039e-2467.19Cytosolic Fe-S cluster assembly factor NBP35 OS=Cr... [more]
NBP35_ASPTN4.318e-2370.69Cytosolic Fe-S cluster assembly factor nbp35 OS=As... [more]
NBP35_CHAGB4.319e-2375.86Cytosolic Fe-S cluster assembly factor NBP35 OS=Ch... [more]
NUBP1_DICDI9.532e-2372.41Cytosolic Fe-S cluster assembly factor NUBP1 homol... [more]
NBP35_KLULA2.730e-2262.50Cytosolic Fe-S cluster assembly factor NBP35 OS=Kl... [more]
NBP35_SCHPO2.731e-2262.50Cytosolic Fe-S cluster assembly factor nbp35 OS=Sc... [more]
NBP35_ASPFU4.615e-2268.97Cytosolic Fe-S cluster assembly factor nbp35 OS=As... [more]
NBP35_ASPOR4.621e-2268.97Cytosolic Fe-S cluster assembly factor nbp35 OS=As... [more]
NBP35_YARLI6.006e-2274.14Cytosolic Fe-S cluster assembly factor NBP35 OS=Ya... [more]
NBP35_PHANO6.006e-2268.97Cytosolic Fe-S cluster assembly factor NBP35 OS=Ph... [more]

Pages

back to top
Libraries
Library NameType
DevOvary1cdna_library
Properties
Property NameValue
Genbank descriptionC32001C10EF DevOvary1 Citrus clementina cDNA clone C32001C10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876182 ID=FC876182|Name=FC876182|organism=Citrus clementina|type=EST|length=731bp
GAAAACAAACCAAATTGGCAAATTCCCAAAACCTAAAAATCCCTAAATTT
ATCTCCGCTTCCCCAGCTGCTCCATCAGCTTCTCACTTCACTCTCCTCCG
GCAGCCAACAGCCGACGTTTATTGCCCCACCCTAACACCGAATTAAGGAG
CCACCACCTTCAGCAGCGATCCACCGTTCACGCGCGACGCAGCAGAGCCA
GCAACCCAGCAGTAGTGCAGCACCAAACGGGCGACGCAACAGTGACCCAC
ACCCACCAGCACCACCGTGCGACGTAGCTGCAGCCAATCGAACACGCGCG
ACGCAGCAGCAGCTATCTCAGCTCCAACGCGACCTGAACCCAGCAGCACC
AGCAGCGCACGCGAACCAACAGCAAACCATCACCAACTCCATCCCAACTC
TCCTCCTTTGCTTTCATTCACATACTAAGAAGCAGAAGAACTACTATTAT
AAGAGAAGCCACCAATGGAGAATGGAGAAATTCCAGAAAATGCTAATGAA
CATTGCCCTGGTCCTCAATCAGAGTCTGCAGGAGAATCTGATGATTGCCA
AGGATGCCCTAATCAAGAAGCTTGTGCTACCGCCCCAAAAGGCCCTGACC
CTGACTTGGTTGCTATTGCTGAACGAATGGCTACTGTTAAGCATAAGATA
CTGGTTTTATCGGGTAAGGGGTGGAGTTGGAAAAAGCACATTCTCTGCCC
AGCTCTCATATGCACTAGCGGCTATGGATTT
back to top