FC877882

Overview
NameFC877882
Unique NameFC877882
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length925
Libraries
Library NameType
IVIA1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6288 contig Ccv1_Contig6288:136..1060. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_RAT (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Rattus norvegicus GN=Coq2 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 2.712e-64
Identity = 119/220 (54.09%), Postives = 146/220 (66.36%), Query Frame = 1
Query:  265 PRQARAYAKLARLDKPIGTWLLAWPCMWSITMAAPPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGSLDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSKEWTTGFGIACI 924
            PR  + Y +L RLDKPIGTWLL  PC WSI +AA PG FPD+ M+              CT+ND+ DRD D  VERT  RPIA+G ++                      N +S  +GA+SLLLV +YPLMKR TFWPQ  LGLTFNWGALLGW+AVKGS D AV  P+Y SGV WTL+YDTIYAHQDK+DD  +G+KSTAL F +++K+W +GFG+A +
Sbjct:   68 PRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVERTANRPIAAGDISAFQSFVFLGAQLTLALGVLLHLNYYSIAMGAASLLLVVTYPLMKRVTFWPQLALGLTFNWGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTALLFRENTKQWLSGFGVAMV 287          
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_MOUSE (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Mus musculus GN=Coq2 PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 2.296e-63
Identity = 117/220 (53.18%), Postives = 145/220 (65.91%), Query Frame = 1
Query:  265 PRQARAYAKLARLDKPIGTWLLAWPCMWSITMAAPPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGSLDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSKEWTTGFGIACI 924
            PR  + Y +L RLDKPIGTWLL  PC WSI +AA PG FPD+ M+              CT+ND+ DRD D  V RT  RPIA+G ++                      N +S  +GA+SLLLV +YPLMKR TFWPQ  LGLTFNWGALLGW+AVKGS D AV  P+Y SGV WTL+YDTIYAHQDK+DD  +G+KSTAL F +++++W +GFG+A +
Sbjct:   68 PRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIAMGAASLLLVVTYPLMKRITFWPQLALGLTFNWGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTALLFQENTRQWLSGFGVAMV 287          
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_HUMAN (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Homo sapiens GN=COQ2 PE=1 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 8.724e-63
Identity = 115/220 (52.27%), Postives = 144/220 (65.45%), Query Frame = 1
Query:  265 PRQARAYAKLARLDKPIGTWLLAWPCMWSITMAAPPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGSLDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSKEWTTGFGIACI 924
            PR  + Y +L RLDKPIGTWLL  PC WSI +AA PG FPD+ M+              CT+ND+ D+D D  V RT  RPIA+G ++                      N +S  LGA SLLLV +YPLMKR ++WPQ  LGLTFNWGALLGW+A+KGS D +V  P+Y SGV WTL+YDTIYAHQDK DD+ +G+KSTALRFG+++K W +GF +A +
Sbjct:   68 PRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIALGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCDPSVCLPLYFSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML 287          
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_DROME (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Drosophila melanogaster GN=Coq2 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 5.655e-62
Identity = 115/217 (53.00%), Postives = 146/217 (67.28%), Query Frame = 1
Query:  274 ARAYAKLARLDKPIGTWLLAWPCMWSITMAAPPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGSLDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSKEWTTGFGIACI 924
            A+ YA+L R+D+PIGT+LL WPC WSI ++A  G +PD  M+              CT+NDL D+DID  VERTRLRP+ASG ++                      N  S +LGASSL LV +YPLMKR T+WPQ  LG+ FNWGALLGW A +GS++LA   P+Y+SGV WT+VYDTIYAHQDK DDL++GVKSTALRFG+++K W +GF  A +
Sbjct:   77 AKPYAQLMRIDRPIGTYLLFWPCAWSIALSADAGCWPDLTMLGLFGTGALIMRGAGCTINDLWDKDIDAKVERTRLRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQSILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGVCWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTAAML 293          
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_BOVIN (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Bos taurus GN=COQ2 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.806e-61
Identity = 114/220 (51.82%), Postives = 142/220 (64.55%), Query Frame = 1
Query:  265 PRQARAYAKLARLDKPIGTWLLAWPCMWSITMAAPPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGSLDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSKEWTTGFGIACI 924
            PR  + Y +L RLDKPIGTWLL  PC WSI +AA PG  PD+ M+              CT+ND+ DRD D  V RT  RPIA+G ++                      N +S  LGA+SLLLV +YPLMKR T+WPQ  LGLTFNWGALLGW+AVKGS D +V  P+Y SG+ WTL+YDTIYAHQDK+DD  +G+KSTAL F + +K+W +GF +A +
Sbjct:   68 PRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADPGCLPDWYMLSLFGTGAVLMRGAGCTINDMWDRDYDKKVTRTASRPIAAGDISTFRSFVFLGGQLTLALGVLLCLNYYSIALGAASLLLVTTYPLMKRITYWPQLALGLTFNWGALLGWSAVKGSCDPSVCLPLYFSGIMWTLIYDTIYAHQDKKDDALIGLKSTALLFREDTKKWLSGFSVAML 287          
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_DROPS (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=coq2 PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 6.252e-61
Identity = 113/216 (52.31%), Postives = 144/216 (66.67%), Query Frame = 1
Query:  277 RAYAKLARLDKPIGTWLLAWPCMWSITMAAPPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGSLDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSKEWTTGFGIACI 924
            + YA+L R+D+PIGT+LL WPC WSI ++A  G +PD  M+              CT+NDL D+DID  VERTR RP+ASG ++                      N  S +LGASSL LV +YPLMKR T+WPQ  LG+ FNWGALLGW A +GS++LA   P+Y+SGV WT+VYDTIYAHQDK DDL++GVKSTALRFG+++K W +GF  A +
Sbjct:   84 KPYAQLMRIDRPIGTYLLFWPCAWSIALSADAGCWPDLTMLGLFGTGALIMRGAGCTINDLWDKDIDAKVERTRTRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQSILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGVCWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTAAML 299          
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_CAEEL (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Caenorhabditis elegans GN=coq-2 PE=2 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 2.627e-59
Identity = 109/220 (49.55%), Postives = 133/220 (60.45%), Query Frame = 1
Query:  265 PRQARAYAKLARLDKPIGTWLLAWPCMWSITMAAPPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGSLDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSKEWTTGFGIACI 924
            P   + Y +L R+DKPIGTWLL WPC WSI MA P G  P   M+              C +NDL D+D D  VERT+LRP+A G LT                      N +S  +GASS+ LV  YPL KRFT+WPQ  LGLTFNWGALLGW A+KG L  +  F MY + + WTL+YDTIYAHQDK DD+ +GVKSTALR G  +K+W + FG+  +
Sbjct:   59 PPNLKPYLQLMRVDKPIGTWLLYWPCTWSIAMATPAGQLPSIYMLSLFGAGAFLMRSAGCVINDLWDKDFDKKVERTKLRPLACGSLTEKQAIGLLAGLLSSSLAILLQLNWYSVAVGASSMALVVGYPLAKRFTYWPQFVLGLTFNWGALLGWCALKGDLSSSAPFWMYAAALQWTLIYDTIYAHQDKADDIMIGVKSTALRLGADTKKWLSAFGVGTV 278          
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_AEDAE (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Aedes aegypti GN=coq2 PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 5.852e-59
Identity = 109/214 (50.93%), Postives = 138/214 (64.49%), Query Frame = 1
Query:  283 YAKLARLDKPIGTWLLAWPCMWSITMAAPPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGSLDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSKEWTTGFGIACI 924
            YA+L R+D+PIG+WLL WPC WSI ++AP G +PD   +              CT+ND+ DRDID  V RTR RP+ +G LT                      N +S +LGASSL LV  YPLMKR T WPQ  LG+TFNWGALLGW+A +GS+  +   P+Y++GV WT+VYDTIYAHQDK DD  +G+KSTA+RFGD++K W +GF  A I
Sbjct:  119 YARLMRIDRPIGSWLLFWPCGWSIALSAPAGCWPDLWTLTLFGAGAFIMRGAGCTINDMWDRDIDGKVARTRNRPLVAGELTSADAWFFLGAQLGVGLLILLELNWYSIVLGASSLGLVIIYPLMKRITHWPQLVLGMTFNWGALLGWSATQGSVMWSACLPLYVAGVCWTIVYDTIYAHQDKVDDALLGIKSTAIRFGDNTKLWLSGFSTAMI 332          
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_DICDI (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Dictyostelium discoideum GN=coq2 PE=3 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.110e-52
Identity = 103/216 (47.69%), Postives = 134/216 (62.04%), Query Frame = 1
Query:  247 WIDLYLPRQARAYAKLARLDKPIGTWLLAWPCMWSITMAAPPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRI-LGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGSLDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSK 891
            WI  + P   + Y +L+R+DKPIG WLL +PC WSI++AAP G FPD K M              C +ND+ D   D+ VERT+ RPIAS  LT                       N+  I L ASSL +V  YP MKRFT++PQ  LGL FNWGAL G++A+ GS + ++V P+Y++G+ WT+VYDTIYAHQDK DD+ VGVKSTAL+F + S+
Sbjct:  160 WISKF-PNSVQPYLRLSRVDKPIGVWLLLYPCCWSISLAAPAGSFPDLKTMLVFGIGAYVMRSAGCVINDMADYKFDSKVERTKTRPIASKQLTHKQSLIFLGGQLLASFGLILSSLNYYTIALCASSLPIVVLYPFMKRFTYYPQFVLGLAFNWGALAGYSAIAGSCNWSIVAPLYLAGISWTMVYDTIYAHQDKRDDILVGVKSTALKFAEKSR 374          
BLAST of FC877882 vs. ExPASy Swiss-Prot
Match: COQ2_SCHPO (Para-hydroxybenzoate--polyprenyltransferase, mitochondrial OS=Schizosaccharomyces pombe GN=coq2 PE=1 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 4.658e-40
Identity = 91/220 (41.36%), Postives = 127/220 (57.73%), Query Frame = 1
Query:  247 WIDLYLPRQARAYAKLARLDKPIGTWLLAWPCMWSITMAA---PPGHFPDFKMMXXXXXXXXXXXXXXCTVNDLLDRDIDNMVERTRLRPIASGLLTPXXXXXXXXXXXXXXXXXXXXXNNFSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGS--LDLAVVFPMYISGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSSK 891
            W DL+  R  + YA+++R   P GT+LL  PC WSI MAA           KM+              C +NDL DR++D  VER++ RP+ASG L+                      N ++  LG +SL+ V  YP MKR T++PQ  LGLTF +GA++GW A+ G   ++ +VV P+Y+S + W ++YDTIYAHQDK DD+K  + STALRFGD++K
Sbjct:   57 WKDLFSKRW-QYYAEISRAGSPTGTYLLYSPCTWSILMAAYAYDSSLVNVTKMLALFGVGSFLMRSAGCVINDLWDRELDAKVERSKSRPLASGKLSVRQAISLLSVQLTASLGILLQLNPYTIKLGVASLVPVCIYPAMKRITYYPQVVLGLTFGYGAVMGWPALAGEACMNWSVVAPLYLSTISWIVLYDTIYAHQDKRDDVKANIYSTALRFGDNTK 275          
The following BLAST results are available for this feature:
BLAST of FC877882 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
COQ2_RAT2.712e-6454.09Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]
COQ2_MOUSE2.296e-6353.18Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]
COQ2_HUMAN8.724e-6352.27Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]
COQ2_DROME5.655e-6253.00Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]
COQ2_BOVIN2.806e-6151.82Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]
COQ2_DROPS6.252e-6152.31Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]
COQ2_CAEEL2.627e-5949.55Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]
COQ2_AEDAE5.852e-5950.93Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]
COQ2_DICDI3.110e-5247.69Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]
COQ2_SCHPO4.658e-4041.36Para-hydroxybenzoate--polyprenyltransferase, mitoc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionIC0AAA15CA07RM1 IVIA1 Citrus clementina cDNA clone IC0AAA15CA07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC877882 ID=FC877882|Name=FC877882|organism=Citrus clementina|type=EST|length=925bp
CGCGTTTTCCGGAGGAGCAGATACCTAAAACCATCGTTGTCTCTTCTCCT
CAGCGGCAACAACAATCCATCTAATCCAGTCCTAAACCCTAAACTTAGCC
CTCATGTAGCCAAATTGACGAATCATTACCGTTGGATGCCAAATTCTGAA
CAAAATTTCAGATACGCATGGGTAGCAAGCATCTGTACAACACCGTCGCA
GTCAAGTGTTGAGAAAGAGACTAGTAGTAGTAATGAGAAATCATCGTGGA
TTGACTTGTATTTGCCGAGACAAGCGAGGGCTTATGCGAAGCTGGCTCGG
CTTGATAAGCCGATCGGGACGTGGCTGCTGGCTTGGCCTTGTATGTGGTC
AATTACAATGGCGGCGCCACCTGGACACTTTCCGGATTTCAAAATGATGG
CGCTCTTTGGCTGTGGCGCTCTCCTTCTACGCGGGGCCGGGTGTACCGTT
AATGACCTCCTTGATAGGGATATTGATAATATGGTGGAACGCACAAGGTT
AAGGCCCATTGCGAGTGGTCTTCTAACACCGTTTCAAGGACTTTCTTTTC
TTGGGTTTCAATTGCTTTTAGGTCTTGGGATTCTTCTCCAGTTGAATAAT
TTTAGCCGCATTCTGGGGGCTTCATCTTTGCTGTTAGTCTTCTCCTACCC
CCTCATGAAGAGGTTTACTTTTTGGCCTCAAGCCTATCTAGGTTTGACCT
TCAACTGGGGAGCCTTATTAGGATGGGCTGCAGTCAAAGGGAGTTTAGAT
CTGGCTGTTGTGTTCCCAATGTACATTTCTGGAGTTTTTTGGACTCTCGT
GTATGATACAATATATGCACATCAGGATAAAGAAGATGATTTGAAAGTTG
GTGTAAAATCTACTGCTTTGAGATTTGGGGATTCTTCTAAGGAATGGACT
ACTGGGTTCGGAATTGCATGCATAA
back to top