FC917917
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FC917917 vs. ExPASy Swiss-Prot
Match: ISCU_MOUSE (Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Mus musculus GN=Iscu PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 9.665e-13 Identity = 34/44 (77.27%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 4 EETGQIVDACFKTFGCGSAIASSSVATEWVKGKQIQEVLSIKNT 135 +E G+IVDA FKTFGCGSAIASSS+ATEWVKGK ++E L+IKNT Sbjct: 81 DEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNT 124
BLAST of FC917917 vs. ExPASy Swiss-Prot
Match: ISCU_HUMAN (Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Homo sapiens GN=ISCU PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 9.665e-13 Identity = 34/44 (77.27%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 4 EETGQIVDACFKTFGCGSAIASSSVATEWVKGKQIQEVLSIKNT 135 +E G+IVDA FKTFGCGSAIASSS+ATEWVKGK ++E L+IKNT Sbjct: 80 DEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNT 123
BLAST of FC917917 vs. ExPASy Swiss-Prot
Match: NIFU_BUCAI (NifU-like protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum GN=nifU PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.069e-11 Identity = 33/43 (76.74%), Postives = 36/43 (83.72%), Query Frame = 1 Query: 7 ETGQIVDACFKTFGCGSAIASSSVATEWVKGKQIQEVLSIKNT 135 E G I DACFKT+GCGSAIASSS+ TEWVKGK I+E SIKNT Sbjct: 49 EKGIIEDACFKTYGCGSAIASSSLVTEWVKGKSIEEAESIKNT 91
BLAST of FC917917 vs. ExPASy Swiss-Prot
Match: NIFU_BUCAP (NifU-like protein OS=Buchnera aphidicola subsp. Schizaphis graminum GN=nifU PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.927e-11 Identity = 31/43 (72.09%), Postives = 35/43 (81.40%), Query Frame = 1 Query: 7 ETGQIVDACFKTFGCGSAIASSSVATEWVKGKQIQEVLSIKNT 135 E G I DACFKT+GCGSAIASSS+ TEW+KGK I E +IKNT Sbjct: 49 EQGIIEDACFKTYGCGSAIASSSLVTEWIKGKSITEAEAIKNT 91 The following BLAST results are available for this feature:
BLAST of FC917917 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC917917 ID=FC917917; Name=FC917917; organism=Citrus clementina; type=EST; length=632bpback to top |