FC919304

Overview
NameFC919304
Unique NameFC919304
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length607
Libraries
Library NameType
PCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC919304_ssr438 microsatellite FC919304_ssr438:438..449. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2562 contig Ccv1_Contig2562:245..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.132e-31
Identity = 58/97 (59.79%), Postives = 78/97 (80.41%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P+  AITCGQV+++LAPCIP++R GG  PP  CC+G+R++N  ARTTPDRQAACNCLK+   ++ G+ PN AA LP +CG+ IPY+ISPST+C+ V+
Sbjct:   22 PIAQAITCGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.479e-31
Identity = 62/97 (63.92%), Postives = 75/97 (77.32%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P T A++CGQV++SLAPCI +L  GG  PP  CCSGV+SLN AA+TTPDRQAAC CLK AY +I G+    AA  P +CG+ IPYKISPSTDCS+V+
Sbjct:   21 PYTEALSCGQVSSSLAPCISYLTKGGAVPPA-CCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.931e-31
Identity = 60/96 (62.50%), Postives = 77/96 (80.21%), Query Frame = 1
Query:  103 VTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            V +AITCGQVT+SLAPCI ++R+GG  PP  CC+G+R++NG ARTT DRQ ACNCLK   G+I G+ PN AAGLP +CG+ +PYKIS ST+C+ V+
Sbjct:   21 VAHAITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 7.339e-31
Identity = 61/92 (66.30%), Postives = 75/92 (81.52%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            ITCGQV++SLAPCI +LR GG   P  CC+GVRSLN AA+TT DRQAACNCLK A+ +I+G+  N+AAGLP +CG+ +PYKISPSTDC  V+
Sbjct:    1 ITCGQVSSSLAPCINYLRAGG-VVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUPE (Non-specific lipid-transfer protein 1 OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.808e-29
Identity = 56/92 (60.87%), Postives = 74/92 (80.43%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            ITCGQV+++LAPCIP++R GG  PP  CC+G+R++N  ARTTPDRQAACNCLK+   ++ G+ PN AA LP +CG+ IPYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 6.869e-29
Identity = 54/96 (56.25%), Postives = 75/96 (78.12%), Query Frame = 1
Query:  103 VTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            V +AITC QV+A+LAPCI ++R+GG  PP  CC+G++++NG A+TTPDRQAACNCLK   G++ G+ P  A  LP +CG+ +PYKIS ST+C+ V+
Sbjct:   21 VAHAITCSQVSANLAPCINYVRSGGAVPPA-CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 8.971e-29
Identity = 56/92 (60.87%), Postives = 73/92 (79.35%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            ITCGQV++SLAPCI ++R GG  PP  CC+G+R++N  ARTTPDR+ ACNCLK+  G+I G+ PN AA LP +CG+ IPYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK 91          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.409e-28
Identity = 52/97 (53.61%), Postives = 74/97 (76.29%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P+  A+TCGQV+++LAPCI ++R GG  PP  CC+G+R++N  A+TT DRQ ACNCLK+   ++ G+  N AA LP +CG+ +PYKISPST+C+ V+
Sbjct:   22 PIAQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDO (Non-specific lipid-transfer protein 1 OS=Prunus domestica PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.210e-27
Identity = 53/92 (57.61%), Postives = 73/92 (79.35%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            ITCGQV+++LAPCI +++ GG  PP  CC+G+R++N  ARTT DR+AACNCLK+  G+I G+ PN AA LP +CG+ +PYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSNLAPCINYVKGGGAVPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK 91          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_TOBAC (Non-specific lipid-transfer protein 1 OS=Nicotiana tabacum GN=LTP1 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.886e-27
Identity = 59/97 (60.82%), Postives = 69/97 (71.13%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P   AITCGQVT++LAPC+ +LR  G  P   CC GV++L  +ARTT DRQ AC CLK A G I GI    AAGLP  CG+ IPYKISPSTDCS+V+
Sbjct:   20 PCAEAITCGQVTSNLAPCLAYLRNTG--PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ 114          
The following BLAST results are available for this feature:
BLAST of FC919304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLTP1_PRUDU1.132e-3159.79Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_HELAN1.479e-3163.92Non-specific lipid-transfer protein OS=Helianthus ... [more]
NLTP_MALDO1.931e-3162.50Non-specific lipid-transfer protein OS=Malus domes... [more]
LTP1_MORNI7.339e-3166.30Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP1_PRUPE1.808e-2960.87Non-specific lipid-transfer protein 1 OS=Prunus pe... [more]
NLTP_PYRCO6.869e-2956.25Non-specific lipid-transfer protein OS=Pyrus commu... [more]
NLTP1_PRUAR8.971e-2960.87Non-specific lipid-transfer protein 1 OS=Prunus ar... [more]
NLTP_PRUAV3.409e-2853.61Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP1_PRUDO2.210e-2757.61Non-specific lipid-transfer protein 1 OS=Prunus do... [more]
NLTP1_TOBAC2.886e-2760.82Non-specific lipid-transfer protein 1 OS=Nicotiana... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC06055A06T7 PCR Citrus clementina cDNA clone C06055A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC919304 ID=FC919304|Name=FC919304|organism=Citrus clementina|type=EST|length=607bp
TGATAACTAGCTATAACCAAGCAAAAGCCTCCCTGAAGAATCCTCATGGC
TGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTGCATTCTGGTGACTGCCC
CGGTGACTAATGCCATAACATGCGGGCAGGTGACAGCCTCCTTGGCTCCA
TGCATCCCTTTCTTGAGAACTGGAGGGCGTTTTCCTCCACCGCCATGCTG
TAGCGGCGTCAGGTCTCTCAACGGCGCCGCCAGAACCACCCCTGACCGCC
AAGCTGCATGCAACTGCTTGAAACGAGCTTACGGAACAATCCGCGGCATC
AAACCTAATGTTGCCGCTGGCCTTCCTANTCAATGTGGAATCAGAATTCC
TTACAAGATCAGCCCCAGCACCGACTGCTCTAGGGTCAGGTGAAGTTGAG
TTTGAGCTCTGTGACTTTCCAAGTATGATTGACTGAGAATAAATAAATAA
AGAATATCTATGTTAATTTCTTTGTCCGAACGAGTCTCCACTTGTATGAG
TTTCACTCTCATGTCATGTTTGTATATTTGCTTTTTATGTCATATTAAAT
ATGTAAACGCGATCTGTGTTTTGAGTGATTAATTATAGTTATTTTGTGGT
ATTATCT
back to top